RegulonDB RegulonDB 10.8: Gene Form
   

cfa gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ydhC cfa ribC ppGpp TSS_1952 TSS_1952 TSS_1951 TSS_1951 TSS_1950 TSS_1950 TSS_1949 TSS_1949 cfap2 cfap2 TSS_1948 (cluster) TSS_1948 (cluster) cfap1 cfap1

Gene      
Name: cfa    Texpresso search in the literature
Synonym(s): ECK1657, EG11531, b1661, cdfA
Genome position(nucleotides): 1741413 --> 1742561 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
47.95
External database links:  
ASAP:
ABE-0005555
CGSC:
10810
ECHOBASE:
EB1493
OU-MICROARRAY:
b1661
PortEco:
cfa
STRING:
511145.b1661
COLOMBOS: cfa


Product      
Name: cyclopropane fatty acyl phospholipid synthase
Synonym(s): CdfA, Cfa
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane,cytosol
Molecular weight: 43.909
Isoelectric point: 5.893
Motif(s):
 
Type Positions Sequence
8 -> 8 E
25 -> 25 S
171 -> 179 VLDIGCGWG
197 -> 202 TISAEQ
108 -> 368 SKKRAWIVGKEHYDLGNDLFSRMLDPFMQYSCAYWKDADNLESAQQAKLKMICEKLQLKPGMRVLDIGCGWGGLAHYMASNYDVSVVGVTISAEQQKMAQERCEGLDVTILLQDYRDLNDQFDRIVSVGMFEHVGPKNYDTYFAVVDRNLKPEGIFLLHTIGSKKTDLNVDPWINKYIFPNGCLPSVRQIAQSSEPHFVMEDWHNFGADYDTTLMAWYERFLAAWPEIADNYSERFKRMFTYYLNACAGAFRARDIQLWQV

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.4 - fatty acids and phosphatidic acid
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
GO:0031234 - extrinsic component of cytoplasmic side of plasma membrane
molecular_function GO:0008168 - methyltransferase activity
GO:0016740 - transferase activity
GO:0008825 - cyclopropane-fatty-acyl-phospholipid synthase activity
GO:0042803 - protein homodimerization activity
GO:0071890 - bicarbonate binding
biological_process GO:0006629 - lipid metabolic process
GO:0008610 - lipid biosynthetic process
GO:0032259 - methylation
GO:0006633 - fatty acid biosynthetic process
GO:0030258 - lipid modification
Note(s): Note(s): ...[more].
Reference(s): [1] Arioz C., et al., 2014
[2] Neubauer C., et al., 2018
[3] Ng TW., et al., 2018
[4] Shabala L., et al., 2008
External database links:  
DIP:
DIP-48026N
ECOCYC:
CFA-MONOMER
ECOLIWIKI:
b1661
INTERPRO:
IPR029063
INTERPRO:
IPR003333
MINT:
MINT-1312967
MODBASE:
P0A9H7
PANTHER:
PTHR10108:SF743
PDB:
6BQC
PFAM:
PF02353
PRIDE:
P0A9H7
PRODB:
PRO_000022268
REFSEQ:
NP_416178
SMR:
P0A9H7
UNIPROT:
P0A9H7


Operon      
Name: cfa         
Operon arrangement:
Transcription unit        Promoter
cfa
cfa


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1948 (cluster) 1741224 forward For this promoter, there
Read more >
[RS-EPT-CBR] [5]
  promoter TSS_1949 1741380 forward nd [RS-EPT-CBR] [5]
  promoter TSS_1950 1741595 forward nd [RS-EPT-CBR] [5]
  promoter TSS_1951 1741685 forward nd [RS-EPT-CBR] [5]
  promoter TSS_1952 1741975 forward nd [RS-EPT-CBR] [5]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Arioz C., Gotzke H., Lindholm L., Eriksson J., Edwards K., Daley DO., Barth A., Wieslander A., 2014, Heterologous overexpression of a monotopic glucosyltransferase (MGS) induces fatty acid remodeling in Escherichia coli membranes., Biochim Biophys Acta 1838(7):1862-70

 [2] Neubauer C., Sessions AL., Booth IR., Bowen BP., Kopf SH., Newman DK., Dalleska NF., 2018, Towards measuring growth rates of pathogens during infections by D2 O-labeling lipidomics., Rapid Commun Mass Spectrom 32(24):2129-2140

 [3] Ng TW., Chan WL., Lai KM., 2018, Influence of membrane fatty acid composition and fluidity on airborne survival of Escherichia coli., Appl Microbiol Biotechnol 102(7):3327-3336

 [4] Shabala L., Ross T., 2008, Cyclopropane fatty acids improve Escherichia coli survival in acidified minimal media by reducing membrane permeability to H+ and enhanced ability to extrude H+., Res Microbiol 159(6):458-61

 [5] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB