RegulonDB RegulonDB 10.9: Gene Form
   

menC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

menE menC menB menH pmrD arnF menD TSS_2519 (cluster) TSS_2519 (cluster) menBp menBp pmrDp3 pmrDp3 pmrDp4 pmrDp4

Gene      
Name: menC    Texpresso search in the literature
Synonym(s): ECK2255, EG11532, b2261
Genome position(nucleotides): 2375000 <-- 2375962 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
58.98
External database links:  
ASAP:
ABE-0007473
CGSC:
518
ECHOBASE:
EB1494
ECOLIHUB:
menC
OU-MICROARRAY:
b2261
STRING:
511145.b2261
COLOMBOS: menC


Product      
Name: o-succinylbenzoate synthase
Synonym(s): MenC
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 35.477
Isoelectric point: 4.571
Motif(s):
 
Type Positions Sequence
176 -> 177 KY
123 -> 281 DMPGEKVAKVKVGLYEAVRDGMVVNLLLEAIPDLHLRLDANRAWTPLKGQQFAKYVNPDYRDRIAFLEEPCKTRDDSRAFARETGIAIAWDESLREPDFAFVAEEGVRAVVIKPTLTGSLEKVREQVQAAHALGLTAVISSSIESSLGLTQLARIAAWL

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.7 - anaerobic respiration
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.3 - cofactors, small molecule carriers --> 1.5.3.11 - menaquinone, ubiquinone
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016829 - lyase activity
GO:0046872 - metal ion binding
GO:0016836 - hydro-lyase activity
GO:0000287 - magnesium ion binding
GO:0043748 - O-succinylbenzoate synthase activity
biological_process GO:0009234 - menaquinone biosynthetic process
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
O-SUCCINYLBENZOATE-COA-SYN-MONOMER
ECOLIWIKI:
b2261
INTERPRO:
IPR036849
INTERPRO:
IPR029065
INTERPRO:
IPR010196
INTERPRO:
IPR013342
INTERPRO:
IPR029017
MODBASE:
P29208
PANTHER:
PTHR13794
PDB:
1R6W
PDB:
2OFJ
PDB:
1FHV
PDB:
1FHU
PFAM:
PF13378
PRIDE:
P29208
PRODB:
PRO_000023202
REFSEQ:
NP_416764
SMART:
SM00922
SMR:
P29208
UNIPROT:
P29208


Operon      
Name: menFDHBCE         
Operon arrangement:
Transcription unit        Promoter
menD-yfbB-menBCE
menBCE
menFD-yfbB-menBCE


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter pmrDp4 2373566 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter pmrDp3 2373574 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter menBp 2376887 reverse nd [AIPP], [ICWHO] [1], [2]
  promoter TSS_2519 (cluster) 2376914 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [3]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [AIPP] Automated inference of promoter position

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Sharma V., Suvarna K., Meganathan R., Hudspeth ME., 1992, Menaquinone (vitamin K2) biosynthesis: nucleotide sequence and expression of the menB gene from Escherichia coli., J Bacteriol 174(15):5057-62

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB