RegulonDB RegulonDB 10.9: Gene Form
   

ibpB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

Gene      
Name: ibpB    Texpresso search in the literature
Synonym(s): ECK3678, EG11535, b3686, hslS, htpE
Genome position(nucleotides): 3866469 <-- 3866897 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
48.95
External database links:  
ASAP:
ABE-0012054
CGSC:
33843
ECHOBASE:
EB1497
ECOLIHUB:
ibpB
OU-MICROARRAY:
b3686
STRING:
511145.b3686
COLOMBOS: ibpB


Product      
Name: small heat shock protein IbpB
Synonym(s): HslS, HtpE, IbpB
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 16.093
Isoelectric point: 4.965
Motif(s):
 
Type Positions Sequence
39 -> 134 KSDDNHYRITLALAGFRQEDLEIQLEGTRLSVKGTPEQPKEEKKWLHQGLMNQPFSLSFTLAENMEVSGATFVNGLLHIDLIRNEPEPIAAQRIAI
26 -> 137 AGESQSFPPYNIEKSDDNHYRITLALAGFRQEDLEIQLEGTRLSVKGTPEQPKEEKKWLHQGLMNQPFSLSFTLAENMEVSGATFVNGLLHIDLIRNEPEPIAAQRIAISER

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.5 - adaptations --> 5.5.2 - temperature extremes
  5 - cell processes --> 5.5 - adaptations --> 5.5.6 - other (mechanical, nutritional, oxidative stress)
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
molecular_function GO:0005515 - protein binding
GO:0042802 - identical protein binding
biological_process GO:0009408 - response to heat
GO:0050821 - protein stabilization
GO:1990169 - stress response to copper ion
External database links:  
DIP:
DIP-48244N
ECOCYC:
EG11535-MONOMER
ECOLIWIKI:
b3686
INTERPRO:
IPR008978
INTERPRO:
IPR037913
INTERPRO:
IPR022848
INTERPRO:
IPR002068
MINT:
P0C058
MODBASE:
P0C058
PFAM:
PF00011
PRIDE:
P0C058
PRODB:
PRO_000022982
PROSITE:
PS01031
REFSEQ:
NP_418141
UNIPROT:
P0C058


Operon      
Name: ibpAB         
Operon arrangement:
Transcription unit        Promoter
ibpB
ibpAB


Transcriptional Regulation      
Display Regulation             
Activated by: IHF


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yidEp6 3866390 reverse Similarity to the consensus
Read more >
[ICWHO] [1]



RegulonDB