RegulonDB RegulonDB 10.9: Gene Form
   

yidE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yidE glvC yidP ibpB terminator yidEp6 yidEp6

Gene      
Name: yidE    Texpresso search in the literature
Synonym(s): ECK3677, EG11536, b3685, yibE
Genome position(nucleotides): 3864612 <-- 3866273 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.89
External database links:  
ASAP:
ABE-0012051
ECHOBASE:
EB1498
ECOLIHUB:
yidE
OU-MICROARRAY:
b3685
STRING:
511145.b3685
COLOMBOS: yidE


Product      
Name: putative transport protein YidE
Synonym(s): YibE, YidE
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 58.939
Isoelectric point: 8.448
Motif(s):
 
Type Positions Sequence
393 -> 413 GFPAALKLGLAGGPLIMALIL
11 -> 179 LALVAVVGLFIGNVKFRGIGLGIGGVLFGGIIVGHFVSQAGMTLSSDMLHVIQEFGLILFVYTIGIQVGPGFFASLRVSGLRLNLFAVLIVIIGGLVTAILHKLFDIPLPVVLGIFSGAVTNTPALGAGQQILRDLGTPMEMVDQMGMSYAMAYPFGICGILFTMWMLR
95 -> 115 LFAVLIVIIGGLVTAILHKLF
464 -> 484 LSWIGYGALITAVPLITVGIL
191 -> 276 QQHESSRTNGGALIKTINIRVENPNLHDLAIKDVPILNGDKIICSRLKREETLKVPSPDTIIQLGDLLHLVGQPADLHNAQLVIGQ

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.9.B - Putative uncharacterized transport protein
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0008324 - cation transmembrane transporter activity
GO:0022857 - transmembrane transporter activity
biological_process GO:0006813 - potassium ion transport
GO:0055085 - transmembrane transport
GO:0098655 - cation transmembrane transport
Note(s): Note(s): ...[more].
Reference(s): [1] Jindal S., et al., 2019
External database links:  
DIP:
DIP-12444N
ECOCYC:
EG11536-MONOMER
ECOLIWIKI:
b3685
INTERPRO:
IPR006512
INTERPRO:
IPR036721
INTERPRO:
IPR023018
INTERPRO:
IPR006037
PFAM:
PF02080
PFAM:
PF06826
PRIDE:
P60872
PROSITE:
PS51202
REFSEQ:
NP_418140
SMR:
P60872
UNIPROT:
P60872


Operon      
Name: yidE         
Operon arrangement:
Transcription unit        Promoter
yidE


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yidEp6 3866390 reverse Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Jindal S., Yang L., Day PJ., Kell DB., 2019, Involvement of multiple influx and efflux transporters in the accumulation of cationic fluorescent dyes by Escherichia coli., BMC Microbiol 19(1):195

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB