RegulonDB RegulonDB 10.8: Gene Form
   

wrbA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

wrbA ycdF yccJ ymdF CsgD CsgD CsgD wrbAp wrbAp

Gene      
Name: wrbA    Texpresso search in the literature
Synonym(s): ECK0995, EG11540, b1004
Genome position(nucleotides): 1067112 <-- 1067708 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.94
External database links:  
ASAP:
ABE-0003392
CGSC:
31836
ECHOBASE:
EB1502
OU-MICROARRAY:
b1004
PortEco:
wrbA
STRING:
511145.b1004
COLOMBOS: wrbA


Product      
Name: NAD(P)H:quinone oxidoreductase
Synonym(s): WrbA
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 20.846
Isoelectric point: 5.677
Motif(s):
 
Type Positions Sequence
13 -> 143 GHIETMARAVAEGASKVDGAEVVVKRVPETMPPQLFEKAGGKTQTAPVATPQELADYDAIIFGTPTRFGNMSGQMRTFLDQTGGLWASGALYGKLASVFSSTGTGGGQEQTITSTWTTLAHHGMVIVPIGY
78 -> 80 TRF
2 -> 198 AKVLVLYYSMYGHIETMARAVAEGASKVDGAEVVVKRVPETMPPQLFEKAGGKTQTAPVATPQELADYDAIIFGTPTRFGNMSGQMRTFLDQTGGLWASGALYGKLASVFSSTGTGGGQEQTITSTWTTLAHHGMVIVPIGYAAQELFDVSQVRGGTPYGATTIAGGDGSRQPSQEELSIARYQGEYVAGLAVKLNG
4 -> 189 VLVLYYSMYGHIETMARAVAEGASKVDGAEVVVKRVPETMPPQLFEKAGGKTQTAPVATPQELADYDAIIFGTPTRFGNMSGQMRTFLDQTGGLWASGALYGKLASVFSSTGTGGGQEQTITSTWTTLAHHGMVIVPIGYAAQELFDVSQVRGGTPYGATTIAGGDGSRQPSQEELSIARYQGEYV
9 -> 14 YSMYGH

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0032991 - protein-containing complex
molecular_function GO:0016491 - oxidoreductase activity
GO:0000166 - nucleotide binding
GO:0050660 - flavin adenine dinucleotide binding
GO:0003955 - NAD(P)H dehydrogenase (quinone) activity
GO:0010181 - FMN binding
GO:0042802 - identical protein binding
GO:0050661 - NADP binding
GO:0051287 - NAD binding
biological_process GO:0006979 - response to oxidative stress
GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
Reference(s): [1] Gotzke H., et al., 2015
[2] Pei Z., et al., 2010
External database links:  
DIP:
DIP-36231N
ECOCYC:
PD01343
ECOLIWIKI:
b1004
INTERPRO:
IPR037513
INTERPRO:
IPR008254
INTERPRO:
IPR010089
INTERPRO:
IPR005025
INTERPRO:
IPR029039
MINT:
P0A8G6
MODBASE:
P0A8G6
PDB:
5F12
PDB:
4YQE
PDB:
3B6M
PDB:
3B6K
PDB:
3B6J
PDB:
3B6I
PDB:
2RG1
PDB:
2R97
PDB:
2R96
PDB:
3ZHO
PFAM:
PF03358
PRIDE:
P0A8G6
PRODB:
PRO_000024221
PROSITE:
PS50902
REFSEQ:
NP_415524
SMR:
P0A8G6
UNIPROT:
P0A8G6


Operon      
Name: wrbA-yccJ         
Operon arrangement:
Transcription unit        Promoter
wrbA-yccJ


Transcriptional Regulation      
Display Regulation             
Activated by: CsgD


Regulation by small RNA    
  Display Regulation
small RNA oxyS


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Gotzke H., Muheim C., Altelaar AF., Heck AJ., Maddalo G., Daley DO., 2015, Identification of Putative Substrates for the Periplasmic Chaperone YfgM in Escherichia coli Using Quantitative Proteomics., Mol Cell Proteomics 14(1):216-26

 [2] Pei Z., Gustavsson T., Roth R., Frejd T., Hagerhall C., 2010, Photolabile ubiquinone analogues for identification and characterization of quinone binding sites in proteins., Bioorg Med Chem 18(10):3457-66


RegulonDB