RegulonDB RegulonDB 10.10: Gene Form
   

flgL gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

rne flgK flgL flgL3\' TSS_1363 TSS_1363 TSS_1362 TSS_1362 TSS_1361 TSS_1361 TSS_1360 TSS_1360 TSS_1359 TSS_1359 TSS_1358 TSS_1358 TSS_1357 TSS_1357 TSS_1356 TSS_1356 TSS_1355 TSS_1355 TSS_1354 TSS_1354 TSS_1353 TSS_1353 TSS_1352 (cluster) TSS_1352 (cluster) TSS_1351 TSS_1351 TSS_1350 TSS_1350 TSS_1349 TSS_1349

Gene      
Name: flgL    Texpresso search in the literature
Synonym(s): ECK1068, EG11545, b1083, flaT
Genome position(nucleotides): 1140033 --> 1140986 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.73
External database links:  
ASAP:
ABE-0003666
CGSC:
757
ECHOBASE:
EB1507
ECOLIHUB:
flgL
OU-MICROARRAY:
b1083
STRING:
511145.b1083
COLOMBOS: flgL


Product      
Name: flagellar hook-filament junction protein 2
Synonym(s): FlaT, FlgL
Sequence: Get amino acid sequence Fasta Format
Cellular location: extracellular space,cell projection
Molecular weight: 34.281
Isoelectric point: 4.38
Motif(s):
 
Type Positions Sequence
168 -> 168 R
4 -> 141 STQMMYQQNMRGITNSQAEWMKYGEQMSTGKRVVNPSDDPIAASQAVVLSQAQAQNSQYTLARTFATQKVSLEESVLSQVTTAIQNAQEKIVYASNGTLSDDDRASLATDIQGLRDQLLNLANTTDGNGRYIFAGYKT

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.12 - flagellum
  2 - information transfer --> 2.3 - protein related --> 2.3.4 - chaperoning, repair (refolding)
  5 - cell processes --> 5.3 - motility, chemotaxis, energytaxis (aerotaxis, redoxtaxis etc)
  6 - cell structure --> 6.4 - flagella
Gene Ontology Terms (GO)  
cellular_component GO:0005576 - extracellular region
GO:0009288 - bacterial-type flagellum
GO:0009424 - bacterial-type flagellum hook
molecular_function GO:0005198 - structural molecule activity
biological_process GO:0071973 - bacterial-type flagellum-dependent cell motility
Note(s): Note(s): ...[more].
Reference(s): [1] Fahrner KA., et al., 1994
External database links:  
ECOCYC:
EG11545-MONOMER
ECOLIWIKI:
b1083
INTERPRO:
IPR013384
INTERPRO:
IPR001029
MODBASE:
P29744
PFAM:
PF00669
PRIDE:
P29744
PRODB:
PRO_000022647
REFSEQ:
NP_415601
SMR:
P29744
UNIPROT:
P29744


Operon      
Name: flgKL         
Operon arrangement:
Transcription unit        Promoter
flgK


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1349 1140510 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1350 1140515 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1351 1140518 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1352 (cluster) 1141491 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1353 1141695 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1354 1141698 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1355 1141705 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1356 1141797 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1357 1142026 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1358 1142028 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1359 1142031 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1360 1142313 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1361 1143233 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1362 1144355 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1363 1144358 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Fahrner KA., Block SM., Krishnaswamy S., Parkinson JS., Berg HC., 1994, A mutant hook-associated protein (HAP3) facilitates torsionally induced transformations of the flagellar filament of Escherichia coli., J Mol Biol 238(2):173-86

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB