RegulonDB RegulonDB 11.0: Gene Form
   

rnt gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

lhr rnt gloA  MicA lhrp lhrp rntp rntp

Gene      
Name: rnt    Texpresso search in the literature
Synonym(s): ECK1648, EG11547, b1652
Genome position(nucleotides): 1728347 --> 1728994
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.17
External database links:  
ASAP:
ABE-0005523
CGSC:
32271
ECHOBASE:
EB1509
ECOLIHUB:
rnt
OU-MICROARRAY:
b1652
STRING:
511145.b1652
COLOMBOS: rnt


Product      
Name: ribonuclease T
Synonym(s): RNase T, Rnt
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 23.523
Isoelectric point: 5.054
Motif(s):
 
Type Positions Sequence Comment
13 -> 15 RFR NBS1 motif, with conserved residues Arg-13 and Arg-15. Required for substrate binding.
15 -> 15 R UniProt: Strongly reduces affinity for RNA..
20 -> 194 VVIDVETAGFNAKTDALLEIAAITLKMDEQGWLMPDTTLHFHVEPFVGANLQPEALAFNGIDPNDPDRGAVSEYEALHEIFKVVRKGIKASGCNRAIMVAHNANFDHSFMMAAAERASLKRNPFHPFATFDTAALAGLALGQTVLSKACQTAGMDFDSTQAHSALYDTERTAVLF UniProt: Exonuclease.
23 -> 25 DVE Exo I DEDD exonuclease motif, with conserved residues Asp-23 and Glu-25. Required for catalysis.
25 -> 25 E UniProt: Nearly abolishes enzyme activity..

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.2 - degradation of macromolecules --> 1.2.1 - RNA
  1 - metabolism --> 1.2 - degradation of macromolecules --> 1.2.2 - DNA
  2 - information transfer --> 2.1 - DNA related --> 2.1.5 - DNA degradation
  2 - information transfer --> 2.2 - RNA related --> 2.2.4 - RNA degradation
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003676 - nucleic acid binding
GO:0004518 - nuclease activity
GO:0004527 - exonuclease activity
GO:0005515 - protein binding
GO:0016787 - hydrolase activity
GO:0008408 - 3'-5' exonuclease activity
GO:0046872 - metal ion binding
GO:0000175 - 3'-5'-exoribonuclease activity
GO:0004540 - ribonuclease activity
GO:0016896 - exoribonuclease activity, producing 5'-phosphomonoesters
GO:0000287 - magnesium ion binding
GO:0042802 - identical protein binding
GO:0042803 - protein homodimerization activity
GO:0008310 - single-stranded DNA 3'-5' exodeoxyribonuclease activity
biological_process GO:0031125 - rRNA 3'-end processing
GO:0034415 - tRNA 3'-trailer cleavage, exonucleolytic
GO:0006974 - cellular response to DNA damage stimulus
GO:0045004 - DNA replication proofreading
GO:0006396 - RNA processing
GO:0008033 - tRNA processing
GO:0042780 - tRNA 3'-end processing
GO:0043628 - ncRNA 3'-end processing
GO:0034644 - cellular response to UV
GO:0090305 - nucleic acid phosphodiester bond hydrolysis
GO:0090501 - RNA phosphodiester bond hydrolysis
GO:0090503 - RNA phosphodiester bond hydrolysis, exonucleolytic
External database links:  
ALPHAFOLD:
P30014
DIP:
DIP-10734N
ECOCYC:
EG11547-MONOMER
ECOLIWIKI:
b1652
INTERPRO:
IPR013520
INTERPRO:
IPR036397
INTERPRO:
IPR005987
INTERPRO:
IPR012337
MODBASE:
P30014
PANTHER:
PTHR30231:SF2
PDB:
3NH2
PDB:
3NH1
PDB:
3NH0
PDB:
3NGZ
PDB:
3NGY
PDB:
2IS3
PDB:
3V9S
PDB:
4KB1
PDB:
4KB0
PDB:
4KAZ
PDB:
3VA3
PDB:
3VA0
PDB:
3V9Z
PDB:
3V9X
PDB:
3V9U
PDB:
3V9W
PFAM:
PF00929
PRIDE:
P30014
PRODB:
PRO_000023800
REFSEQ:
NP_416169
SMART:
SM00479
SMR:
P30014
SWISSMODEL:
P30014
UNIPROT:
P30014


Operon      
Name: rnt-lhr         
Operon arrangement:
Transcription unit        Promoter
rnt-lhr
lhr


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB