RegulonDB RegulonDB 10.8: Gene Form
   

lhr gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

lhr rnt grxD TSS_1932 (cluster) TSS_1932 (cluster) lhrp lhrp

Gene      
Name: lhr    Texpresso search in the literature
Synonym(s): ECK1649, EG11548, b1653, rhlF
Genome position(nucleotides): 1729087 --> 1733703 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.9
External database links:  
ASAP:
ABE-0005525
CGSC:
35720
ECHOBASE:
EB1510
OU-MICROARRAY:
b1653
PortEco:
lhr
STRING:
511145.b1653
COLOMBOS: lhr


Product      
Name: putative ATP-dependent helicase Lhr
Synonym(s): Lhr, RhlF, member of ATP-dependent helicase superfamily II
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 169.38
Isoelectric point: 6.722
Motif(s):
 
Type Positions Sequence
349 -> 417 VFIARSHHGSVSKEQRAITEQALKSGELRCVVATSSLELGIDMGAVDLVIQVATPLSVASGLQRIGRAG
31 -> 218 TAVQPQTWHVAARSEHALVIAPTGSGKTLAAFLYALDRLFREGGEDTREAHKRKTSRILYISPIKALGTDVQRNLQIPLKGIADERRRRGETEVNLRVGIRTGDTPAQERSKLTRNPPDILITTPESLYLMLTSRARETLRGVETVIIDEVHAVAGSKRGAHLALSLERLDALLHTSAQRIGLSATVR
679 -> 867 VPGSRHLVLERCRDEIGDWRIILHSPYGRRVHEPWAVAIAGRIHALWGADASVVASDDGIVARIPDTDGKLPDAAIFLFEPEKLLQIVREAVGSSALFAARFRECAARALLMPGRTPGHRTPLWQQRLRASQLLEIAQGYPDFPVILETLRECLQDVYDLPALERLMRRLNGGEIQISDVTTTTPSPFA
51 -> 58 APTGSGKT
179 -> 182 DEVH

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005886 - plasma membrane
molecular_function GO:0003676 - nucleic acid binding
GO:0004386 - helicase activity
GO:0016787 - hydrolase activity
GO:0016818 - hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides
GO:0003723 - RNA binding
GO:0000166 - nucleotide binding
GO:0003724 - RNA helicase activity
GO:0005524 - ATP binding
Note(s): Note(s): ...[more].
Reference(s): [1] Ordonez H., et al., 2013
External database links:  
DIP:
DIP-10097N
ECOCYC:
EG11548-MONOMER
ECOLIWIKI:
b1653
INTERPRO:
IPR003593
INTERPRO:
IPR027417
INTERPRO:
IPR014001
INTERPRO:
IPR013701
INTERPRO:
IPR011545
INTERPRO:
IPR001650
MINT:
MINT-1293547
MODBASE:
P30015
PFAM:
PF00270
PFAM:
PF00271
PFAM:
PF08494
PRIDE:
P30015
PROSITE:
PS51194
PROSITE:
PS51192
REFSEQ:
NP_416170
SMART:
SM00490
SMART:
SM00487
SMART:
SM00382
SMR:
P30015
UNIPROT:
P30015


Operon      
Name: rnt-lhr         
Operon arrangement:
Transcription unit        Promoter
lhr
rnt-lhr


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1932 (cluster) 1733911 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Ordonez H., Shuman S., 2013, Mycobacterium smegmatis Lhr Is a DNA-dependent ATPase and a 3'-to-5' DNA translocase and helicase that prefers to unwind 3'-tailed RNA:DNA hybrids., J Biol Chem 288(20):14125-34

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB