RegulonDB RegulonDB 10.9: Gene Form
   

hcxB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

hcxB ybiB ybiE TSS_962 TSS_962

Gene      
Name: hcxB    Texpresso search in the literature
Synonym(s): ECK0790, EG11581, b0801, ybiC
Genome position(nucleotides): 836351 --> 837436 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.62
External database links:  
ASAP:
ABE-0002738
ECHOBASE:
EB1541
ECOLIHUB:
ybiC
OU-MICROARRAY:
b0801
STRING:
511145.b0801
COLOMBOS: hcxB


Product      
Name: hydroxycarboxylate dehydrogenase B
Synonym(s): HcxB, YbiC
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 38.897
Isoelectric point: 6.415
Motif(s):
 
Type Positions Sequence
8 -> 338 DAQTLHSFIQAVFRQMGSEEQEAKLVADHLIAANLAGHDSHGIGMIPSYVRSWSQGHLQINHHAKTVKEAGAAVTLDGDRAFGQVAAHEAMALGIEKAHQHGIAAVALHNSHHIGRIGYWAEQCAAAGFVSIHFVSVVGIPMVAPFHGRDSRFGTNPFCVVFPRKDNFPLLLDYATSAIAFGKTRVAWHKGVPVPPGCLIDVNGVPTTNPAVMQESPLGSLLTFAEHKGYALAAMCEILGGALSGGKTTHQETLQTSPDAILNCMTTIIINPELFGAPDCNAQTEAFAEWVKASPHDDDKPILLPGEWEVNTRRERQKQGIPLDAGSWQAI
122 -> 124 GRI
23 -> 24 MG
313 -> 316 GEWE
178 -> 182 LLDYA

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0102742 - R(+)-3,4-dihydroxyphenyllactate:NADP+ oxidoreductase activity
GO:0047995 - hydroxyphenylpyruvate reductase activity
GO:0016491 - oxidoreductase activity
biological_process GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-11426N
ECOCYC:
EG11581-MONOMER
ECOLIWIKI:
b0801
INTERPRO:
IPR043144
INTERPRO:
IPR003767
INTERPRO:
IPR036111
INTERPRO:
IPR043143
MODBASE:
P30178
PANTHER:
PTHR11091
PDB:
2G8Y
PFAM:
PF02615
PRIDE:
P30178
REFSEQ:
NP_415322
SMR:
P30178
SWISSMODEL:
P30178
UNIPROT:
P30178


Operon      
Name: hcxB         
Operon arrangement:
Transcription unit        Promoter
hcxB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_962 836318 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB