RegulonDB RegulonDB 10.9: Gene Form
   

lipB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ybeF lipB ybeD lipBp2 lipBp2 lipBp3 lipBp3 ybeFp5 ybeFp5 ybeFp6 ybeFp6 ybeFp4 ybeFp4 ybeFp7 ybeFp7

Gene      
Name: lipB    Texpresso search in the literature
Synonym(s): ECK0623, EG11591, b0630, cde, lip
Genome position(nucleotides): 661637 <-- 662278 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
47.66
External database links:  
ASAP:
ABE-0002160
CGSC:
555
ECHOBASE:
EB1549
ECOLIHUB:
lipB
OU-MICROARRAY:
b0630
STRING:
511145.b0630
COLOMBOS: lipB


Product      
Name: lipoyl(octanoyl) transferase
Synonym(s): Cde, Lip, LipB, lipoate-protein ligase B, lipoyl (octanoyl)-acyl carrier protein:protein transferase, lipoyl-[acyl-carrier-protein]-protein-N-lipoyltransferase, lipoyl-protein ligase
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 23.883
Isoelectric point: 6.237
Motif(s):
 
Type Positions Sequence
32 -> 207 DSTLDEIWLVEHYPVFTQGQAGKAEHILMPGDIPVIQSDRGGQVTYHGPGQQVMYVLLNLKRRKLGVRELVTLLEQTVVNTLAELGIEAHPRADAPGVYVGEKKICSLGLRIRRGCSFHGLALNVNMDLSPFLRINPCGYAGMEMAKISQWKPEATTNNIAPRLLENILALLNNPD
71 -> 78 RGGQVTYH
147 -> 147 C
33 -> 33 S
138 -> 140 SLG

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.3 - cofactors, small molecule carriers --> 1.5.3.3 - lipoate
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0102555 - octanoyl transferase activity (acting on glycine-cleavage complex H protein)
GO:0003824 - catalytic activity
GO:0005515 - protein binding
GO:0016740 - transferase activity
GO:0016746 - transferase activity, transferring acyl groups
GO:0033819 - lipoyl(octanoyl) transferase activity
GO:0016415 - octanoyltransferase activity
biological_process GO:0006464 - cellular protein modification process
GO:0009106 - lipoate metabolic process
GO:0009107 - lipoate biosynthetic process
GO:0009249 - protein lipoylation
GO:0010629 - negative regulation of gene expression
Note(s): Note(s): ...[more].
Reference(s): [1] Chang YY., et al., 1991
[2] Creaghan IT., et al., 1978
[3] Hermes FA., et al., 2009
[4] Hermes FA., et al., 2014
[5] Miller JR., et al., 2000
External database links:  
ECOCYC:
EG11591-MONOMER
ECOLIWIKI:
b0630
INTERPRO:
IPR004143
INTERPRO:
IPR000544
INTERPRO:
IPR020605
PFAM:
PF03099
PRIDE:
P60720
PRODB:
PRO_000023093
PROSITE:
PS51733
PROSITE:
PS01313
REFSEQ:
NP_415163
SMR:
P60720
UNIPROT:
P60720


Operon      
Name: ybeD-lipB         
Operon arrangement:
Transcription unit        Promoter
ybeD-lipB
ybeD-lipB
lipB
ybeD


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ybeFp7 661386 reverse Similarity to the consensus
Read more >
[ICWHO] [6]
  promoter ybeFp4 661460 reverse Similarity to the consensus
Read more >
[ICWHO] [6]
  promoter ybeFp6 661510 reverse Similarity to the consensus
Read more >
[ICWHO] [6]
  promoter ybeFp5 661545 reverse Similarity to the consensus
Read more >
[ICWHO] [6]
  promoter lipBp3 662399 reverse Similarity to the consensus
Read more >
[ICWHO] [6]
  promoter lipBp2 662401 reverse Similarity to the consensus
Read more >
[ICWHO] [6]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Chang YY., Cronan JE., Li SJ., Reed K., Vanden Boom T., Wang AY., 1991, Locations of the lip, poxB, and ilvBN genes on the physical map of Escherichia coli., J Bacteriol 173(17):5258-9

 [2] Creaghan IT., Guest JR., 1978, Succinate dehydrogenase-dependent nutritional requirement for succinate in mutants of Escherichia coli K12., J Gen Microbiol 107(1):1-13

 [3] Hermes FA., Cronan JE., 2009, Scavenging of cytosolic octanoic acid by mutant LplA lipoate ligases allows growth of Escherichia coli strains lacking the LipB octanoyltransferase of lipoic acid synthesis., J Bacteriol 191(22):6796-803

 [4] Hermes FA., Cronan JE., 2014, An NAD synthetic reaction bypasses the lipoate requirement for aerobic growth of Escherichia coli strains blocked in succinate catabolism., Mol Microbiol

 [5] Miller JR., Busby RW., Jordan SW., Cheek J., Henshaw TF., Ashley GW., Broderick JB., Cronan JE., Marletta MA., 2000, Escherichia coli LipA is a lipoyl synthase: in vitro biosynthesis of lipoylated pyruvate dehydrogenase complex from octanoyl-acyl carrier protein., Biochemistry 39(49):15166-78

 [6] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB