RegulonDB RegulonDB 10.9: Gene Form
   

clsA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

clsA yciU yciY TSS_1682 (cluster) TSS_1682 (cluster) clsAp clsAp TSS_1681 TSS_1681 TSS_1680 TSS_1680 TSS_1679 TSS_1679 TSS_1678 TSS_1678 TSS_1677 TSS_1677 yciUp4 yciUp4 yciUp5 yciUp5 yciUp6 yciUp6 TSS_1676 TSS_1676 TSS_1675 (cluster) TSS_1675 (cluster)

Gene      
Name: clsA    Texpresso search in the literature
Synonym(s): ECK1243, EG11608, b1249, cls, nov, yciJ
Genome position(nucleotides): 1307185 <-- 1308645 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.68
External database links:  
ASAP:
ABE-0004186
CGSC:
915
ECHOBASE:
EB1565
ECOLIHUB:
cls
OU-MICROARRAY:
b1249
STRING:
511145.b1249
COLOMBOS: clsA


Product      
Name: cardiolipin synthase A
Synonym(s): Cls, ClsA, Nov, YciJ, cardiolipin synthase 1
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 54.822
Isoelectric point: 8.434
Motif(s):
 
Type Positions Sequence
30 -> 32 KRR
332 -> 446 SAREYLIMTTPYFVPSDDLLHAICTAAQRGVDVSIILPRKNDSMLVGWASRAFFTELLAAGVKIYQFEGGLLHTKSVLVDGELSLVGTVNLDMRSLWLNFEITLAIDDKGFGADL
2 -> 60 TTVYTLVSWLAILGYWLLIAGVTLRILMKRRAVPSAMAWLLIIYILPLVGIIAYLAVGE
23 -> 59 VTLRILMKRRAVPSAMAWLLIIYILPLVGIIAYLAVG
38 -> 58 MAWLLIIYILPLVGIIAYLAV

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.1 - phospholipid
  5 - cell processes --> 5.6 - protection --> 5.6.4 - drug resistance/sensitivity
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0003824 - catalytic activity
GO:0016740 - transferase activity
GO:0016780 - phosphotransferase activity, for other substituted phosphate groups
GO:0008808 - cardiolipin synthase activity
biological_process GO:0006629 - lipid metabolic process
GO:0008654 - phospholipid biosynthetic process
GO:0032049 - cardiolipin biosynthetic process
Note(s): Note(s): ...[more].
Reference(s): [1] Babu M., et al., 2011
[2] Heber S., et al., 1991
[3] Hiraoka S., et al., 1993
[4] Homma H., et al., 1982
[5] Li C., et al., 2016
[6] Rakonjac J., et al., 1992
[7] Shibuya I., et al., 1992
[8] Shibuya I., et al., 1985
External database links:  
ECOCYC:
CARDIOLIPSYN-MONOMER
ECOLIWIKI:
b1249
INTERPRO:
IPR022924
INTERPRO:
IPR001736
INTERPRO:
IPR025202
INTERPRO:
IPR030840
INTERPRO:
IPR027379
MODBASE:
P0A6H8
PFAM:
PF13396
PFAM:
PF13091
PRIDE:
P0A6H8
PROSITE:
PS50035
REFSEQ:
NP_415765
SMART:
SM00155
UNIPROT:
P0A6H8


Operon      
Name: clsA-yciU         
Operon arrangement:
Transcription unit        Promoter
clsA-yciU


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1675 (cluster) 1307175 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [9]
  promoter TSS_1676 1307286 reverse nd [RS-EPT-CBR] [9]
  promoter yciUp6 1307349 reverse Similarity to the consensus
Read more >
[ICWHO] [10]
  promoter yciUp5 1307352 reverse Similarity to the consensus
Read more >
[ICWHO] [10]
  promoter yciUp4 1307359 reverse Similarity to the consensus
Read more >
[ICWHO] [10]
  promoter TSS_1677 1307454 reverse nd [RS-EPT-CBR] [9]
  promoter TSS_1678 1307894 reverse nd [RS-EPT-CBR] [9]
  promoter TSS_1679 1307905 reverse nd [RS-EPT-CBR] [9]
  promoter TSS_1680 1307924 reverse nd [RS-EPT-CBR] [9]
  promoter TSS_1681 1308634 reverse nd [RS-EPT-CBR] [9]
  promoter TSS_1682 (cluster) 1308761 forward For this promoter, there
Read more >
[RS-EPT-CBR] [9]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Babu M., Diaz-Mejia JJ., Vlasblom J., Gagarinova A., Phanse S., Graham C., Yousif F., Ding H., Xiong X., Nazarians-Armavil A., Alamgir M., Ali M., Pogoutse O., Pe'er A., Arnold R., Michaut M., Parkinson J., Golshani A., Whitfield C., Wodak SJ., Moreno-Hagelsieb G., Greenblatt JF., Emili A., 2011, Genetic interaction maps in Escherichia coli reveal functional crosstalk among cell envelope biogenesis pathways., PLoS Genet 7(11):e1002377

 [2] Heber S., Tropp BE., 1991, Genetic regulation of cardiolipin synthase in Escherichia coli., Biochim Biophys Acta 1129(1):1-12

 [3] Hiraoka S., Matsuzaki H., Shibuya I., 1993, Active increase in cardiolipin synthesis in the stationary growth phase and its physiological significance in Escherichia coli., FEBS Lett 336(2):221-4

 [4] Homma H., Nojima S., 1982, Synthesis of various phospholipids from 2-acyl lysophospholipids by Escherichia coli extract., J Biochem 91(4):1103-10

 [5] Li C., Tan BK., Zhao J., Guan Z., 2016, In Vivo and in Vitro Synthesis of Phosphatidylglycerol by an Escherichia coli Cardiolipin Synthase., J Biol Chem 291(48):25144-25153

 [6] Rakonjac J., Milic M., Ajdic-Predic D., Santos D., Ivanisevic R., Savic DJ., 1992, nov: a new genetic locus that affects the response of Escherichia coli K-12 to novobiocin., Mol Microbiol 6(11):1547-53

 [7] Shibuya I., Hiraoka S., 1992, Cardiolipin synthase from Escherichia coli., Methods Enzymol 209:321-30

 [8] Shibuya I., Yamagoe S., Miyazaki C., Matsuzaki H., Ohta A., 1985, Biosynthesis of novel acidic phospholipid analogs in Escherichia coli., J Bacteriol 161(2):473-7

 [9] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [10] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB