RegulonDB RegulonDB 11.0: Gene Form
   

baeR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

mdtD baeS baeR yegP TSS_2404 TSS_2404

Gene      
Name: baeR    Texpresso search in the literature
Synonym(s): ECK2075, EG11618, b2079
Genome position(nucleotides): 2164276 --> 2164998
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.08
External database links:  
ASAP:
ABE-0006884
CGSC:
30764
ECHOBASE:
EB1575
ECOLIHUB:
baeR
OU-MICROARRAY:
b2079
STRING:
511145.b2079
COLOMBOS: baeR


Product      
Name: DNA-binding transcriptional activator BaeR
Synonym(s): BaeR, BaeR response regulator
Sequence: Get amino acid sequence Fasta Format
Regulator Family: OmpR
Cellular location: cytosol
Molecular weight: 27.656
Isoelectric point: 5.448
Motif(s):
 
Type Positions Sequence Comment
12 -> 125 RILIVEDEPKLGQLLIDYLRAASYAPTLISHGDQVLPYVRQTPPDLILLDLMLPGTDGLTLCREIRRFSDIPIVMVTAKIEEIDRLLGLEIGADDYICKPYSPREVVARVKTIL UniProt: Response regulatory;
13 -> 121 ILIVEDEPKLGQLLIDYLRAASYAPTLISHGDQVLPYVRQTPPDLILLDLMLPGTDGLTLCREIRRFSDIPIVMVTAKIEEIDRLLGLEIGADDYICKPYSPREVVARV
131 -> 234 QRELQQQDAESPLIIDEGRFQASWRGKMLDLTPAEFRLLKTLSHEPGKVFSREQLLNHLYDDYRVVTDRTIDSHIKNLRRKLESLDAEQSFIRAVYGVGYRWEA UniProt: OmpR/PhoB-type.
157 -> 231 KMLDLTPAEFRLLKTLSHEPGKVFSREQLLNHLYDDYRVVTDRTIDSHIKNLRRKLESLDAEQSFIRAVYGVGYR

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.2 - activator
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.4 - complex regulation --> 3.1.2.4.3 - two component regulatory systems (external signal)
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
GO:0032993 - protein-DNA complex
molecular_function GO:0003677 - DNA binding
GO:0000156 - phosphorelay response regulator activity
GO:0042802 - identical protein binding
GO:0000976 - transcription cis-regulatory region binding
GO:0000987 - cis-regulatory region sequence-specific DNA binding
GO:0001216 - DNA-binding transcription activator activity
biological_process GO:0006355 - regulation of transcription, DNA-templated
GO:0000160 - phosphorelay signal transduction system
GO:2000144 - positive regulation of DNA-templated transcription, initiation
GO:2001023 - regulation of response to drug
Evidence: [APPH] Assay of protein purified to homogeneity
[GEA] Gene expression analysis
Reference(s): [1] Baranova N., et al., 2002
[2] Pao GM., et al., 1995
[3] Parkinson JS. 1993
[4] Parkinson JS., et al., 1992
[5] Stock JB., et al., 1990
External database links:  
ALPHAFOLD:
P69228
DIP:
DIP-9198N
ECOCYC:
BAER-MONOMER
ECOLIWIKI:
b2079
INTERPRO:
IPR039420
INTERPRO:
IPR001867
INTERPRO:
IPR011006
INTERPRO:
IPR016032
INTERPRO:
IPR036388
INTERPRO:
IPR001789
MODBASE:
P69228
PANTHER:
PTHR48111
PDB:
4B09
PFAM:
PF00486
PFAM:
PF00072
PRIDE:
P69228
PRODB:
PRO_000022196
PROSITE:
PS50110
PROSITE:
PS51755
REFSEQ:
NP_416583
SMART:
SM00448
SMART:
SM00862
SMR:
P69228
SWISSMODEL:
P69228
UNIPROT:
P69228


Operon      
Name: mdtABCD-baeSR         
Operon arrangement:
Transcription unit        Promoter
mdtABCD-baeSR
baeSR


Transcriptional Regulation      
Display Regulation             
Activated by: BaeR, CpxR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2404 2164246 forward nd [RS-EPT-CBR] [6]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Baranova N., Nikaido H., 2002, The baeSR two-component regulatory system activates transcription of the yegMNOB (mdtABCD) transporter gene cluster in Escherichia coli and increases its resistance to novobiocin and deoxycholate., J Bacteriol 184(15):4168-76

 [2] Pao GM., Saier MH., 1995, Response regulators of bacterial signal transduction systems: selective domain shuffling during evolution., J Mol Evol 40(2):136-54

 [3] Parkinson JS., 1993, Signal transduction schemes of bacteria., Cell 73(5):857-71

 [4] Parkinson JS., Kofoid EC., 1992, Communication modules in bacterial signaling proteins., Annu Rev Genet 26:71-112

 [5] Stock JB., Stock AM., Mottonen JM., 1990, Signal transduction in bacteria., Nature 344(6265):395-400

 [6] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB