RegulonDB RegulonDB 10.9: Gene Form
   

metN gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

metN metQ metI gmhB Fis Fis Fis Fis MetJ MetJ anti-anti-terminator gmhBp gmhBp metNp metNp TSS_415 TSS_415 TSS_414 TSS_414 TSS_413 (cluster) TSS_413 (cluster) TSS_412 TSS_412 TSS_411 (cluster) TSS_411 (cluster) TSS_410 TSS_410 TSS_409 TSS_409 TSS_408 (cluster) TSS_408 (cluster) TSS_407 TSS_407 TSS_406 TSS_406 TSS_405 TSS_405 TSS_404 TSS_404 TSS_403 TSS_403 TSS_402 TSS_402 TSS_401 TSS_401 TSS_400 TSS_400 TSS_399 TSS_399

Gene      
Name: metN    Texpresso search in the literature
Synonym(s): ECK0199, EG11621, abc, b0199, metD
Genome position(nucleotides): 221614 <-- 222645 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.91
Reference(s): [1] Gal J., et al., 2002
[2] Merlin C., et al., 2002
External database links:  
ASAP:
ABE-0000671
ECHOBASE:
EB1578
ECOLIHUB:
metN
OU-MICROARRAY:
b0199
STRING:
511145.b0199
COLOMBOS: metN


Product      
Name: L-methionine/D-methionine ABC transporter ATP binding subunit
Synonym(s): Abc, MetD, MetN
Sequence: Get amino acid sequence Fasta Format
Cellular location: cell wall,inner membrane
Molecular weight: 37.788
Isoelectric point: 6.351
Motif(s):
 
Type Positions Sequence
278 -> 283 VDAPLL
265 -> 343 CVPMLRLEFTGQSVDAPLLSETARRFNVNNNIISAQMDYAGGVKFGIMLTEMHGTQQDTQAAIAWLQEHHVKVEVLGYV
295 -> 296 NI
21 -> 169 LNNVSLHVPAGQIYGVIGASGAGKSTLIRCVNLLERPTEGSVLVDGQELTTLSESELTKARRQIGMIFQHFNLLSSRTVFGNVALPLELDNTPKDEVKRRVTELLSLVGLGDKHDSYPSNLSGGQKQRVAIARALASNPKVLLCDEATS
1 -> 230 MIKLSNITKVFHQGTRTIQALNNVSLHVPAGQIYGVIGASGAGKSTLIRCVNLLERPTEGSVLVDGQELTTLSESELTKARRQIGMIFQHFNLLSSRTVFGNVALPLELDNTPKDEVKRRVTELLSLVGLGDKHDSYPSNLSGGQKQRVAIARALASNPKVLLCDEATSALDPATTRSILELLKDINRRLGLTILLITHEMDVVKRICDCVAVISNGELIEQDTVSEVFS

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases --> 4.3.A.1.a - ABC superfamily ATP binding cytoplasmic component
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0009276 - Gram-negative-bacterium-type cell wall
GO:0055052 - ATP-binding cassette (ABC) transporter complex, substrate-binding subunit-containing
molecular_function GO:0003824 - catalytic activity
GO:0005515 - protein binding
GO:0016887 - ATPase activity
GO:0042626 - ATPase-coupled transmembrane transporter activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0015424 - ATPase-coupled amino acid transmembrane transporter activity
GO:0048474 - D-methionine transmembrane transporter activity
GO:0015191 - L-methionine transmembrane transporter activity
biological_process GO:0008152 - metabolic process
GO:0006865 - amino acid transport
GO:0048473 - D-methionine transport
GO:0055085 - transmembrane transport
GO:0015821 - methionine transport
GO:0003333 - amino acid transmembrane transport
GO:1902475 - L-alpha-amino acid transmembrane transport
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-9027N
ECOCYC:
ABC-MONOMER
ECOLIWIKI:
b0199
INTERPRO:
IPR012692
INTERPRO:
IPR017908
INTERPRO:
IPR027417
INTERPRO:
IPR003439
INTERPRO:
IPR003593
INTERPRO:
IPR017871
INTERPRO:
IPR018449
INTERPRO:
IPR026253
INTERPRO:
IPR041701
MODBASE:
P30750
PANTHER:
PTHR43166:SF5
PDB:
3TUJ
PDB:
6CVL
PDB:
3TUZ
PDB:
3TUI
PDB:
3DHX
PDB:
3DHW
PFAM:
PF00005
PFAM:
PF09383
PRIDE:
P30750
PRODB:
PRO_000023218
PROSITE:
PS51264
PROSITE:
PS00211
PROSITE:
PS50893
REFSEQ:
NP_414741
SMART:
SM00930
SMART:
SM00382
SMR:
P30750
SWISSMODEL:
P30750
UNIPROT:
P30750


Operon      
Name: metNIQ         
Operon arrangement:
Transcription unit        Promoter
metNIQ


Transcriptional Regulation      
Display Regulation             
Activated by: HypT
Repressed by: MetJ


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_399 220386 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_400 220394 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_401 220539 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_402 220543 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_403 220638 forward nd [RS-EPT-CBR] [3]
  promoter TSS_404 220964 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_405 220970 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_406 220975 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_407 221009 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_408 (cluster) 221015 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_409 221017 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_410 221019 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_411 (cluster) 221041 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_412 221053 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_413 (cluster) 221681 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_414 221903 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_415 221928 reverse nd [RS-EPT-CBR] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Gal J., Szvetnik A., Schnell R., Kalman M., 2002, The metD D-methionine transporter locus of Escherichia coli is an ABC transporter gene cluster., J Bacteriol 184(17):4930-2

 [2] Merlin C., Gardiner G., Durand S., Masters M., 2002, The Escherichia coli metD locus encodes an ABC transporter which includes Abc (MetN), YaeE (MetI), and YaeC (MetQ)., J Bacteriol 184(19):5513-7

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB