RegulonDB RegulonDB 11.1: Gene Form
   

potI gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

potG potH potI ybjO terminator anti-terminator anti-anti-terminator ybjOp5 ybjOp5 ybjOp4 ybjOp4

Gene      
Name: potI    Texpresso search in the literature
Synonym(s): ECK0848, EG11632, b0857
Genome position(nucleotides): 897084 --> 897929
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.73
External database links:  
ASAP:
ABE-0002919
CGSC:
31703
ECHOBASE:
EB1589
ECOLIHUB:
potI
OU-MICROARRAY:
b0857
STRING:
511145.b0857
COLOMBOS: potI


Product      
Name: putrescine ABC transporter membrane subunit PotI
Synonym(s): PotI
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 30.541
Isoelectric point: 10.101
Motif(s):
 
Type Positions Sequence Comment
14 -> 33 VILLLGFTFLYAPMLMLVIY UniProt: Helical.
65 -> 260 VGLSLTIAACAATAAAILGTIAAVVLVRFGRFRGSNGFAFMITAPLVMPDVITGLSLLLLFVALAHAIGWPADRGMLTIWLAHVTFCTAYVAVVISSRLRELDRSIEEAAMDLGATPLKVFFVITLPMIMPAIISGWLLAFTLSLDDLVIASFVSGPGATTLPMLVFSSVRMGVNPEINALATLILGAVGIVGFIA UniProt: ABC transmembrane type-1.
69 -> 88 LTIAACAATAAAILGTIAAV UniProt: Helical.
81 -> 273 ILGTIAAVVLVRFGRFRGSNGFAFMITAPLVMPDVITGLSLLLLFVALAHAIGWPADRGMLTIWLAHVTFCTAYVAVVISSRLRELDRSIEEAAMDLGATPLKVFFVITLPMIMPAIISGWLLAFTLSLDDLVIASFVSGPGATTLPMLVFSSVRMGVNPEINALATLILGAVGIVGFIAWYLMARAEKQRIR
116 -> 135 ITGLSLLLLFVALAHAIGWP UniProt: Helical.

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.4 - amines
  6 - cell structure --> 6.1 - membrane
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases --> 4.3.A.1.m - ABC superfamily, membrane component
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
GO:0043190 - ATP-binding cassette (ABC) transporter complex
GO:0055052 - ATP-binding cassette (ABC) transporter complex, substrate-binding subunit-containing
biological_process GO:0055085 - transmembrane transport
GO:0015847 - putrescine transport
Note(s): Note(s): ...[more].
External database links:  
ALPHAFOLD:
P0AFL1
ECOCYC:
POTI-MONOMER
ECOLIWIKI:
b0857
INTERPRO:
IPR000515
INTERPRO:
IPR035906
PFAM:
PF00528
PRIDE:
P0AFL1
PRODB:
PRO_000023574
PROSITE:
PS50928
REFSEQ:
NP_415378
UNIPROT:
P0AFL1


Operon      
Name: potFGHI         
Operon arrangement:
Transcription unit        Promoter
potFGHI
potFGHI


Transcriptional Regulation      
Display Regulation             
Activated by: NtrC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ybjOp4 897852 forward nd [COMP-AINF] [1]
  promoter ybjOp5 897947 forward nd [COMP-AINF] [1]


Evidence    

 [COMP-AINF] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB