RegulonDB RegulonDB 10.9: Gene Form
   

nohD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

tfaD nohD aaaD ylcI

Gene      
Name: nohD    Texpresso search in the literature
Synonym(s): ECK0552, EG11635, b0560, nohB
Genome position(nucleotides): 580834 --> 581379 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.56
External database links:  
ASAP:
ABE-0001915
ECHOBASE:
EB1591
ECOLIHUB:
nohB
OU-MICROARRAY:
b0560
STRING:
511145.b0560
COLOMBOS: nohD


Product      
Name: DLP12 prophage; putative DNA-packaging protein NohD
Synonym(s): NohB, NohD
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 20.428
Isoelectric point: 4.596
Motif(s):
 
Type Positions Sequence
1 -> 164 MEVNKKQLADIFGASIRTIQNWQEQGMPVLRGGGKGNEVLYDSAAVIKWYAERDAEIENEKLRREVEELLQASETDLQPGTIEYERHRLTRAQADAQELKNARDSAEVVETAFCTFVLSRIAGEIASILDGIPLSVQRRFPELENRHVDFLKRDIIKAMNKAAA

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG11635-MONOMER
ECOLIWIKI:
b0560
INTERPRO:
IPR036388
INTERPRO:
IPR010906
INTERPRO:
IPR009061
MODBASE:
P31062
PFAM:
PF07471
PRIDE:
P31062
PRODB:
PRO_000023397
REFSEQ:
NP_415092
SMR:
P31062
SWISSMODEL:
P31062
UNIPROT:
P31062


Operon      
Name: nohD         
Operon arrangement:
Transcription unit        Promoter
nohD


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB