RegulonDB RegulonDB 11.1: Gene Form
   

marC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ydeA marC marR MarR MarR CpxR AcrR CRP SoxS Rob MarA Cra Fis marRp marRp marCp marCp

Gene      
Name: marC    Texpresso search in the literature
Synonym(s): ECK1522, EG11637, b1529, ydeB, ydeC
Genome position(nucleotides): 1618243 <-- 1618908
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.05
External database links:  
ASAP:
ABE-0005106
ECHOBASE:
EB1593
ECOLIHUB:
marC
OU-MICROARRAY:
b1529
STRING:
511145.b1529
COLOMBOS: marC


Product      
Name: inner membrane protein MarC
Synonym(s): MarC, YdeB, YdeC
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 23.617
Isoelectric point: 8.463
Motif(s):
 
Type Positions Sequence Comment
5 -> 217 FKAIGLGLVVLLPLANPLTTVALFLGLAGNMNSAERNRQSLMASVYVFAIMMVAYYAGQLVMDTFGISIPGLRIAGGLIVAFIGFRMLFPQQKAIDSPEAKSKSEELEDEPSANIAFVPLAMPSTAGPGTIAMIISSASTVRQSSTFADWVLMVAPPLIFFLVAVILWGSLRSSGAIMRLVGKGGIEAISRLMGFLLVCMGVQFIINGILEII
8 -> 28 IGLGLVVLLPLANPLTTVALF UniProt: Helical.
45 -> 65 LMASVYVFAIMMVAYYAGQLV UniProt: Helical.
69 -> 89 FGISIPGLRIAGGLIVAFIGF UniProt: Helical.
119 -> 139 IAFVPLAMPSTAGPGTIAMII UniProt: Helical.

 

Classification:
Multifun Terms (GenProtEC)  
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
Note(s): Note(s): ...[more].
Reference(s): [1] Atsumi S., et al., 2010
[2] Babel H., et al., 2020
[3] Horinouchi T., et al., 2017
[4] Pattrick CA., et al., 2019
External database links:  
ALPHAFOLD:
P0AEY1
ECOCYC:
EG11637-MONOMER
ECOLIWIKI:
b1529
INTERPRO:
IPR002771
PANTHER:
PTHR33508
PFAM:
PF01914
PRIDE:
P0AEY1
REFSEQ:
NP_416046
UNIPROT:
P0AEY1


Operon      
Name: marC         
Operon arrangement:
Transcription unit        Promoter
marC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Atsumi S., Wu TY., Machado IM., Huang WC., Chen PY., Pellegrini M., Liao JC., 2010, Evolution, genomic analysis, and reconstruction of isobutanol tolerance in Escherichia coli., Mol Syst Biol 6:449

 [2] Babel H., Kromer JO., 2020, Evolutionary engineering of E. coli MG1655 for tolerance against isoprenol., Biotechnol Biofuels 13(1):183

 [3] Horinouchi T., Sakai A., Kotani H., Tanabe K., Furusawa C., 2017, Improvement of isopropanol tolerance of Escherichia coli using adaptive laboratory evolution and omics technologies., J Biotechnol 255:47-56

 [4] Pattrick CA., Webb JP., Green J., Chaudhuri RR., Collins MO., Kelly DJ., 2019, Proteomic Profiling, Transcription Factor Modeling, and Genomics of Evolved Tolerant Strains Elucidate Mechanisms of Vanillin Toxicity in Escherichia coli., mSystems 4(4)


RegulonDB