RegulonDB RegulonDB 10.9: Gene Form
   

yafE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

mltD yafD yafE TSS_428 TSS_428 TSS_427 TSS_427 TSS_426 TSS_426 TSS_425 TSS_425

Gene      
Name: yafE    Texpresso search in the literature
Synonym(s): ECK0210, EG11651, b0210
Genome position(nucleotides): 231926 --> 232549 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.04
External database links:  
ASAP:
ABE-0000702
ECHOBASE:
EB1604
ECOLIHUB:
yafE
OU-MICROARRAY:
b0210
STRING:
511145.b0210
COLOMBOS: yafE


Product      
Name: putative S-adenosylmethionine-dependent methyltransferase
Synonym(s): YafE
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 22.991
Isoelectric point: 6.148
Motif(s):
 
Type Positions Sequence
6 -> 96 QGRPTFGAAQNVSAVVAYDLSAHMLDVVAQAAEARQLKNITTRQGYAESLPFADNAFDIVISRYSAHHWHDVGAALREVNRILKPGGRLIV

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0008168 - methyltransferase activity
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG11651-MONOMER
ECOLIWIKI:
b0210
INTERPRO:
IPR013216
INTERPRO:
IPR029063
MODBASE:
P30866
PFAM:
PF08241
PRIDE:
P30866
REFSEQ:
NP_414746
SMR:
P30866
UNIPROT:
P30866


Operon      
Name: yafDE         
Operon arrangement:
Transcription unit        Promoter
yafDE


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_425 231274 forward nd [RS-EPT-CBR] [1]
  promoter TSS_426 231276 forward nd [RS-EPT-CBR] [1]
  promoter TSS_427 231280 forward nd [RS-EPT-CBR] [1]
  promoter TSS_428 231299 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB