RegulonDB RegulonDB 10.8: Gene Form
   

yedE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yedE yedK yedD yedF yedDp5 yedDp5 TSS_2269 TSS_2269 yedEp8 yedEp8 TSS_2268 TSS_2268 TSS_2267 (cluster) TSS_2267 (cluster)

Gene      
Name: yedE    Texpresso search in the literature
Synonym(s): ECK1928, EG11660, b1929
Genome position(nucleotides): 2008277 --> 2009482 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.89
External database links:  
ASAP:
ABE-0006422
ECHOBASE:
EB1612
OU-MICROARRAY:
b1929
PortEco:
yedE
STRING:
511145.b1929
COLOMBOS: yedE


Product      
Name: putative selenium transporter YedE
Synonym(s): YedE
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 44.429
Isoelectric point: 10.555
Motif(s):
 
Type Positions Sequence
237 -> 392 RAQICFTSAFRDMWITGRTHMAKAIIIGMAVSAIGIFSYVQLGVEPKIMWAGPNAVIGGLLFGFGIVLAGGCETGWMYRAVEGQVHYWWVGLGNVIGSTILAYYWDDFAPALATDWDKINLLKTFGPMGGLLVTYLLLFAALMLIIGWEKRFFRRA
284 -> 304 IMWAGPNAVIGGLLFGFGIVL
3 -> 160 WQQFKHAWLIKFWAPIPAVIAAGILSTYYFGITGTFWAVTGEFTRWGGQLLQLFGVHAEEWGYFKIIHLEGSPLTRIDGMMILGMFGGCFAAALWANNVKLRMPRSRIRIMQAIIGGIIAGFGARLAMGCNLAAFFTGIPQFSLHAWFFAIATAIGSW
79 -> 99 IDGMMILGMFGGCFAAALWAN
112 -> 132 IMQAIIGGIIAGFGARLAMGC

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0005515 - protein binding
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-11839N
ECOCYC:
EG11660-MONOMER
ECOLIWIKI:
b1929
INTERPRO:
IPR007272
MINT:
MINT-1246874
PFAM:
PF04143
PRIDE:
P31064
REFSEQ:
NP_416439
SMR:
P31064
UNIPROT:
P31064


Operon      
Name: yedEF         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2267 (cluster) 2008115 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_2268 2008117 reverse nd [RS-EPT-CBR] [1]
  promoter yedEp8 2008155 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_2269 2008240 forward nd [RS-EPT-CBR] [1]
  promoter yedDp5 2008261 reverse Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB