RegulonDB RegulonDB 10.9: Gene Form
   

yedF gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yedE yedK yedD yedF yedDp5 yedDp5 TSS_2269 TSS_2269 yedEp8 yedEp8 TSS_2268 TSS_2268 TSS_2267 (cluster) TSS_2267 (cluster)

Gene      
Name: yedF    Texpresso search in the literature
Synonym(s): ECK1929, EG11661, b1930
Genome position(nucleotides): 2009479 --> 2009712 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
48.29
External database links:  
ASAP:
ABE-0006425
ECHOBASE:
EB1613
ECOLIHUB:
yedF
OU-MICROARRAY:
b1930
STRING:
511145.b1930
COLOMBOS: yedF


Product      
Name: putative sulfurtransferase YedF
Synonym(s): YedF
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 8.639
Isoelectric point: 4.609
Motif(s):
 
Type Positions Sequence
9 -> 77 RLDMVGEPCPYPAVATLEAMPQLKKGEILEVVSDCPQSINNIPLDARNHGYTVLDIQQDGPTIRYLIQK

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
biological_process GO:0006974 - cellular response to DNA damage stimulus
Note(s): Note(s): ...[more].
Evidence: [IHBCE] Inferred by a human based on computational evidence
Reference(s): [1] Yee A., et al., 2002
External database links:  
ECOCYC:
EG11661-MONOMER
ECOLIWIKI:
b1930
INTERPRO:
IPR001455
INTERPRO:
IPR036868
MODBASE:
P0AA31
PDB:
1JE3
PFAM:
PF01206
PRIDE:
P0AA31
PROSITE:
PS01148
REFSEQ:
NP_416440
SMR:
P0AA31
UNIPROT:
P0AA31


Operon      
Name: yedEF         
Operon arrangement:
Transcription unit        Promoter
yedEF


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2267 (cluster) 2008115 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_2268 2008117 reverse nd [RS-EPT-CBR] [2]
  promoter yedEp8 2008155 forward Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter TSS_2269 2008240 forward nd [RS-EPT-CBR] [2]
  promoter yedDp5 2008261 reverse Similarity to the consensus
Read more >
[ICWHO] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Yee A., Chang X., Pineda-Lucena A., Wu B., Semesi A., Le B., Ramelot T., Lee GM., Bhattacharyya S., Gutierrez P., Denisov A., Lee CH., Cort JR., Kozlov G., Liao J., Finak G., Chen L., Wishart D., Lee W., McIntosh LP., Gehring K., Kennedy MA., Edwards AM., Arrowsmith CH., 2002, An NMR approach to structural proteomics., Proc Natl Acad Sci U S A 99(4):1825-30

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB