RegulonDB RegulonDB 10.9: Gene Form
   

modF gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

modF galE modE GalS GalR H-NS CRP H-NS H-NS H-NS HU HU GalR GalS anti-terminator terminator galEp3 galEp3 galEp2 galEp2 galEp1 galEp1

Gene      
Name: modF    Texpresso search in the literature
Synonym(s): ECK0749, EG11677, b0760, chlD, phrA
Genome position(nucleotides): 792316 <-- 793788 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.68
External database links:  
ASAP:
ABE-0002582
ECHOBASE:
EB1628
ECOLIHUB:
modF
OU-MICROARRAY:
b0760
STRING:
511145.b0760
COLOMBOS: modF


Product      
Name: ABC family protein ModF
Synonym(s): ChlD, ModF, ORF6, PhrA
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 54.536
Isoelectric point: 5.448
Motif(s):
 
Type Positions Sequence
320 -> 320 L
422 -> 428 LLILDEP
36 -> 43 GSNGSGKS
23 -> 163 QLTLNAGDSWAFVGSNGSGKSALARALAGELPLLKGERQSQFSHITRLSFEQLQKLVSDEWQRNNTDMLGPGEDDTGRTTAEIIQDEVKDAPRCMQLAQQFGITALLDRRFKYLSTGETRKTLLCQALMSEPDLLILDEPF
4 -> 235 LQILQGTFRLSDTKTLQLPQLTLNAGDSWAFVGSNGSGKSALARALAGELPLLKGERQSQFSHITRLSFEQLQKLVSDEWQRNNTDMLGPGEDDTGRTTAEIIQDEVKDAPRCMQLAQQFGITALLDRRFKYLSTGETRKTLLCQALMSEPDLLILDEPFDGLDVASRQQLAERLASLHQSGITLVLVLNRFDEIPEFVQFAGVLADCTLAETGAKEELLQQALVAQLAHSE

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0043190 - ATP-binding cassette (ABC) transporter complex
molecular_function GO:0042626 - ATPase-coupled transmembrane transporter activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
biological_process GO:0006281 - DNA repair
GO:0006974 - cellular response to DNA damage stimulus
GO:0055085 - transmembrane transport
Note(s): Note(s): ...[more].
Reference(s): [1] Grunden AM., et al., 1996
[2] Moussatova A., et al., 2008
[3] Self WT., et al., 2001
External database links:  
ECOCYC:
MODF-MONOMER
ECOLIWIKI:
b0760
INTERPRO:
IPR003439
INTERPRO:
IPR003593
INTERPRO:
IPR027417
MODBASE:
P31060
PFAM:
PF00005
PRIDE:
P31060
PROSITE:
PS50893
REFSEQ:
NP_415281
SMART:
SM00382
UNIPROT:
P31060


Operon      
Name: modEF         
Operon arrangement:
Transcription unit        Promoter
modEF


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Grunden AM., Ray RM., Rosentel JK., Healy FG., Shanmugam KT., 1996, Repression of the Escherichia coli modABCD (molybdate transport) operon by ModE., J Bacteriol 178(3):735-44

 [2] Moussatova A., Kandt C., O'Mara ML., Tieleman DP., 2008, ATP-binding cassette transporters in Escherichia coli., Biochim Biophys Acta 1778(9):1757-71

 [3] Self WT., Grunden AM., Hasona A., Shanmugam KT., 2001, Molybdate transport., Res Microbiol 152(3-4):311-21


RegulonDB