RegulonDB RegulonDB 10.8: Gene Form
   

aas gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

aas lplT tas omrA omrAp omrAp TSS_3137 TSS_3137 TSS_3136 TSS_3136 lplTp3 lplTp3 TSS_3135 TSS_3135

Gene      
Name: aas    Texpresso search in the literature
Synonym(s): ECK2832, EG11679, b2836
Genome position(nucleotides): 2973855 <-- 2976014 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.64
External database links:  
ASAP:
ABE-0009302
CGSC:
29780
ECHOBASE:
EB1630
OU-MICROARRAY:
b2836
PortEco:
aas
STRING:
511145.b2836
COLOMBOS: aas


Product      
Name: fused 2-acylglycerophospho-ethanolamine acyltransferase/acyl-acyl carrier protein synthetase
Synonym(s): Aas, acyltransferase
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 80.7
Isoelectric point: 9.706
Motif(s):
 
Type Positions Sequence
15 -> 137 RVRVTGDTQALKGERVLITPNHVSFIDGILLGLFLPVRPVFAVYTSISQQWYMRWLKSFIDFVPLDPTQPMAIKHLVRLVEQGRPVVIFPEGRITTTGSLMKIYDGAGFVAAKSGATVIPVRI
202 -> 202 P
233 -> 646 SYRKLLTKTLFVGRILEKYSVEGERIGLMLPNAGISAAVIFGAIARRRMPAMMNYTAGVKGLTSAITAAEIKTIFTSRQFLDKGKLWHLPEQLTQVRWVYLEDLKADVTTADKVWIFAHLLMPRLAQVKQQPEEEALILFTSGSEGHPKGVVHSHKSILANVEQIKTIADFTTNDRFMSALPLFHSFGLTVGLFTPLLTGAEVFLYPSPLHYRIVPELVYDRSCTVLFGTSTFLGHYARFANPYDFYRLRYVVAGAEKLQESTKQLWQDKFGLRILEGYGVTECAPVVSINVPMAAKPGTVGRILPGMDARLLSVPGIEEGGRLQLKGPNIMNGYLRVEKPGVLEVPTAENVRGEMERGWYDTGDIVRFDEQGFVQIQGRAKRFAKIAGEMVSLEMVEQLALGVSPDKVHATAI
281 -> 281 M
258 -> 277 IGLMLPNAGISAAVIFGAIA

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.4 - fatty acids and phosphatidic acid
  2 - information transfer --> 2.3 - protein related --> 2.3.3 - posttranslational modification
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0003824 - catalytic activity
GO:0016740 - transferase activity
GO:0016874 - ligase activity
GO:0016746 - transferase activity, transferring acyl groups
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0008779 - acyl-[acyl-carrier-protein]-phospholipid O-acyltransferase activity
GO:0008922 - long-chain fatty acid [acyl-carrier-protein] ligase activity
biological_process GO:0008152 - metabolic process
GO:0006631 - fatty acid metabolic process
GO:0008654 - phospholipid biosynthetic process
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-9025N
ECOCYC:
AAS-MONOMER
ECOLIWIKI:
b2836
INTERPRO:
IPR002123
INTERPRO:
IPR042099
INTERPRO:
IPR023775
INTERPRO:
IPR020845
INTERPRO:
IPR000873
MINT:
MINT-1308806
MODBASE:
P31119
PFAM:
PF00501
PFAM:
PF01553
PRIDE:
P31119
PRODB:
PRO_000022025
PROSITE:
PS00455
REFSEQ:
NP_417313
SMART:
SM00563
SMR:
P31119
UNIPROT:
P31119


Operon      
Name: aas-lplT         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3135 2971604 forward nd [RS-EPT-CBR] [1]
  promoter lplTp3 2973939 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_3136 2975992 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3137 2976050 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB