RegulonDB RegulonDB 10.9: Gene Form
   

lptB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

rpoN lptB lptA lptC TSS_3524 TSS_3524 TSS_3523 TSS_3523 TSS_3522 TSS_3522 TSS_3521 TSS_3521 TSS_3520 TSS_3520 TSS_3519 TSS_3519 TSS_3518 TSS_3518 TSS_3517 TSS_3517 TSS_3516 TSS_3516 TSS_3515 TSS_3515 TSS_3514 (cluster) TSS_3514 (cluster) rpoNp rpoNp TSS_3513 TSS_3513 lptBp lptBp

Gene      
Name: lptB    Texpresso search in the literature
Synonym(s): ECK3190, EG11680, b3201, yhbG
Genome position(nucleotides): 3343944 --> 3344669 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.41
External database links:  
ASAP:
ABE-0010512
ECHOBASE:
EB1631
ECOLIHUB:
lptB
OU-MICROARRAY:
b3201
STRING:
511145.b3201
COLOMBOS: lptB


Product      
Name: lipopolysaccharide transport system ATP binding protein LptB
Synonym(s): LptB, YhbG
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol,inner membrane
Molecular weight: 26.801
Isoelectric point: 5.868
Motif(s):
 
Type Positions Sequence
4 -> 237 LTAKNLAKAYKGRRVVEDVSLTVNSGEIVGLLGPNGAGKTTTFYMVVGIVPRDAGNIIIDDDDISLLPLHARARRGIGYLPQEASIFRRLSVYDNLMAVLQIRDDLSAEQREDRANELMEEFHIEHLRDSMGQSLSGGERRRVEIARALAANPKFILLDEPFAGVDPISVIDIKRIIEHLRDSGLGVLITDHNVRETLAVCERAYIVSQGHLIAHGTPTEILQDEHVKRVYLGE
150 -> 150 R
20 -> 166 EDVSLTVNSGEIVGLLGPNGAGKTTTFYMVVGIVPRDAGNIIIDDDDISLLPLHARARRGIGYLPQEASIFRRLSVYDNLMAVLQIRDDLSAEQREDRANELMEEFHIEHLRDSMGQSLSGGERRRVEIARALAANPKFILLDEPFA
90 -> 90 F
36 -> 43 GPNGAGKT

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases --> 4.3.A.1.a - ABC superfamily ATP binding cytoplasmic component
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0043190 - ATP-binding cassette (ABC) transporter complex
GO:1990351 - transporter complex
molecular_function GO:0005515 - protein binding
GO:0016887 - ATPase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0015437 - lipopolysaccharide floppase activity
biological_process GO:0015920 - lipopolysaccharide transport
GO:0055085 - transmembrane transport
Note(s): Note(s): ...[more].
Reference(s): [1] Martorana AM., et al., 2016
External database links:  
DIP:
DIP-31876N
ECOCYC:
YHBG-MONOMER
ECOLIWIKI:
b3201
INTERPRO:
IPR032823
INTERPRO:
IPR027417
INTERPRO:
IPR030921
INTERPRO:
IPR003439
INTERPRO:
IPR003593
INTERPRO:
IPR017871
MINT:
P0A9V1
PDB:
4P32
PDB:
6MI8
PDB:
6MI7
PDB:
6MHZ
PDB:
6MHU
PDB:
6MGF
PDB:
6MBN
PDB:
6B8B
PDB:
6B89
PDB:
4P33
PDB:
4P31
PFAM:
PF12399
PFAM:
PF00005
PRIDE:
P0A9V1
PRODB:
PRO_000023114
PROSITE:
PS00211
PROSITE:
PS50893
REFSEQ:
NP_417668
SMART:
SM00382
SMR:
P0A9V1
UNIPROT:
P0A9V1


Operon      
Name: yrbG-kdsDC-lptCAB-rpoN-hpf-ptsN-rapZ-npr         
Operon arrangement:
Transcription unit        Promoter
yrbG-kdsD
yrbG-kdsDC-lptCAB
kdsC-lptCAB
kdsC-lptCAB
kdsC-lptCAB
lptAB
lptAB
lptB-rpoN-hpf-ptsN-yhbJ
rpoN-hpf-ptsN-yhbJ-npr


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3513 3343446 forward nd [RS-EPT-CBR] [2]
  promoter TSS_3514 (cluster) 3345196 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_3515 3345209 forward nd [RS-EPT-CBR] [2]
  promoter TSS_3516 3345220 forward nd [RS-EPT-CBR] [2]
  promoter TSS_3517 3345418 forward nd [RS-EPT-CBR] [2]
  promoter TSS_3518 3345499 forward nd [RS-EPT-CBR] [2]
  promoter TSS_3519 3345526 forward nd [RS-EPT-CBR] [2]
  promoter TSS_3520 3345533 forward nd [RS-EPT-CBR] [2]
  promoter TSS_3521 3345596 forward nd [RS-EPT-CBR] [2]
  promoter TSS_3522 3345796 forward nd [RS-EPT-CBR] [2]
  promoter TSS_3523 3345915 forward nd [RS-EPT-CBR] [2]
  promoter TSS_3524 3346078 forward nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Martorana AM., Benedet M., Maccagni EA., Sperandeo P., Villa R., Deho G., Polissi A., 2016, Functional Interaction between the Cytoplasmic ABC Protein LptB and the Inner Membrane LptC Protein, Components of the Lipopolysaccharide Transport Machinery in Escherichia coli., J Bacteriol 198(16):2192-203

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB