RegulonDB RegulonDB 10.9: Gene Form
   

ptsN gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

rapZ ptsN hpf yrbL3\' npr terminator TSS_3526 TSS_3526 TSS_3525 TSS_3525

Gene      
Name: ptsN    Texpresso search in the literature
Synonym(s): ECK3193, EG11682, b3204, rpoP, yhbI
Genome position(nucleotides): 3346578 --> 3347069 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.24
External database links:  
ASAP:
ABE-0010520
ECHOBASE:
EB1633
ECOLIHUB:
ptsN
OU-MICROARRAY:
b3204
STRING:
511145.b3204
COLOMBOS: ptsN


Shine dalgarno      
Sequence: ggcaggttctTAGGTGaaattATG


Product      
Name: phosphotransferase system enzyme IIA(Ntr)
Synonym(s): EIIA(Ntr), EIIANtr, PtsN, RpoP, YhbI, enzyme IIANtr
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 17.96
Isoelectric point: 5.652
Motif(s):
 
Type Positions Sequence
12 -> 156 SVLNRECTRSRVHCQSKKRALEIISELAAKQLSLPPQVVFEAILTREKMGSTGIGNGIAIPHGKLEEDTLRAVGVFVQLETPIAFDAIDNQPVDLLFALLVPADQTKTHLHTLSLVAKRLADKTICRRLRAAQSDEELYQIITDT
13 -> 155 VLNRECTRSRVHCQSKKRALEIISELAAKQLSLPPQVVFEAILTREKMGSTGIGNGIAIPHGKLEEDTLRAVGVFVQLETPIAFDAIDNQPVDLLFALLVPADQTKTHLHTLSLVAKRLADKTICRRLRAAQSDEELYQIITD

 

Classification:
Multifun Terms (GenProtEC)  
  3 - regulation --> 3.1 - type of regulation --> 3.1.3 - posttranscriptional --> 3.1.3.3 - inhibition / activation of enzymes
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0016740 - transferase activity
GO:0004857 - enzyme inhibitor activity
GO:0016301 - kinase activity
GO:0008982 - protein-N(PI)-phosphohistidine-sugar phosphotransferase activity
GO:0030295 - protein kinase activator activity
biological_process GO:0009401 - phosphoenolpyruvate-dependent sugar phosphotransferase system
GO:0016310 - phosphorylation
GO:0032147 - activation of protein kinase activity
GO:0043086 - negative regulation of catalytic activity
GO:0034219 - carbohydrate transmembrane transport
GO:0010243 - response to organonitrogen compound
GO:0032412 - regulation of ion transmembrane transporter activity
Note(s): Note(s): ...[more].
Evidence: [IDA] Inferred from direct assay
[IMP] Inferred from mutant phenotype
Reference(s): [1] Lee CR., et al., 2007
[2] Luttmann D., et al., 2012
[3] Luttmann D., et al., 2015
[4] Luttmann D., et al., 2009
External database links:  
DIP:
DIP-10604N
ECOCYC:
EG11682-MONOMER
ECOLIWIKI:
b3204
INTERPRO:
IPR006320
INTERPRO:
IPR002178
INTERPRO:
IPR016152
MODBASE:
P69829
PDB:
1A6J
PFAM:
PF00359
PRIDE:
P69829
PRODB:
PRO_000023634
PROSITE:
PS51094
PROSITE:
PS00372
REFSEQ:
NP_417671
SMR:
P69829
UNIPROT:
P69829


Operon      
Name: yrbG-kdsDC-lptCAB-rpoN-hpf-ptsN-rapZ-npr         
Operon arrangement:
Transcription unit        Promoter
yrbG-kdsD
yrbG-kdsDC-lptCAB
kdsC-lptCAB
kdsC-lptCAB
kdsC-lptCAB
lptAB
lptAB
lptB-rpoN-hpf-ptsN-yhbJ
rpoN-hpf-ptsN-yhbJ-npr


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3525 3346195 forward nd [RS-EPT-CBR] [5]
  promoter TSS_3526 3347528 forward nd [RS-EPT-CBR] [5]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Lee CR., Cho SH., Yoon MJ., Peterkofsky A., Seok YJ., 2007, Escherichia coli enzyme IIANtr regulates the K+ transporter TrkA., Proc Natl Acad Sci U S A 104(10):4124-9

 [2] Luttmann D., Gopel Y., Gorke B., 2012, The phosphotransferase protein EIIA(Ntr) modulates the phosphate starvation response through interaction with histidine kinase PhoR in Escherichia coli., Mol Microbiol 86(1):96-110

 [3] Luttmann D., Gopel Y., Gorke B., 2015, Cross-Talk between the Canonical and the Nitrogen-Related Phosphotransferase Systems Modulates Synthesis of the KdpFABC Potassium Transporter in Escherichia coli., J Mol Microbiol Biotechnol 25(2-3):168-77

 [4] Luttmann D., Heermann R., Zimmer B., Hillmann A., Rampp IS., Jung K., Gorke B., 2009, Stimulation of the potassium sensor KdpD kinase activity by interaction with the phosphotransferase protein IIA(Ntr) in Escherichia coli., Mol Microbiol 72(4):978-94

 [5] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB