RegulonDB RegulonDB 10.9: Gene Form
   

yicI gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yicI yicH yicJ

Gene      
Name: yicI    Texpresso search in the literature
Synonym(s): ECK3646, EG11685, b3656
Genome position(nucleotides): 3832219 <-- 3834537 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.05
External database links:  
ASAP:
ABE-0011951
ECHOBASE:
EB1636
ECOLIHUB:
yicI
MIM:
600666
OU-MICROARRAY:
b3656
STRING:
511145.b3656
COLOMBOS: yicI


Product      
Name: α-D-xyloside xylohydrolase
Synonym(s): YicI
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 88.079
Isoelectric point: 5.614
Motif(s):
 
Type Positions Sequence
307 -> 308 CF
240 -> 667 FVIDGPTPKAVLDRYTRFTGRPALPPAWSFGLWLTTSFTTNYDEATVNSFIDGMAERNLPLHVFHFDCFWMKAFQWCDFEWDPLTFPDPEGMIRRLKAKGLKICVWINPYIGQKSPVFKELQEKGYLLKRPDGSLWQWDKWQPGLAIYDFTNPDACKWYADKLKGLVAMGVDCFKTDFGERIPTDVQWFDGSDPQKMHNHYAYIYNELVWNVLKDTVGEEEAVLFARSASVGAQKFPVHWGGDCYANYESMAESLRGGLSIGLSGFGFWSHDIGGFENTAPAHVYKRWCAFGLLSSHSRLHGSKSYRVPWAYDDESCDVVRFFTQLKCRMMPYLYREAARANARGTPMMRAMMMEFPDDPACDYLDRQYMLGDNVMVAPVFTEAGDVQFYLPEGRWTHLWHNDELDGSRWHKQQHGFLSLPVYVRDNT
159 -> 218 GETVYGLGERFTALVRNGQTVETWNRDGGTSTEQAYKNIPFYMTNRGYGVLVNHPQCVSF

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.7 - central intermediary metabolism
Gene Ontology Terms (GO)  
molecular_function GO:0003824 - catalytic activity
GO:0016787 - hydrolase activity
GO:0004553 - hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0016798 - hydrolase activity, acting on glycosyl bonds
GO:0030246 - carbohydrate binding
GO:0042802 - identical protein binding
GO:0080176 - xyloglucan 1,6-alpha-xylosidase activity
GO:0061634 - alpha-D-xyloside xylohydrolase
biological_process GO:0008152 - metabolic process
GO:0005975 - carbohydrate metabolic process
Note(s): Note(s): ...[more].
External database links:  
CAZY:
GH31
DIP:
DIP-12433N
ECOCYC:
EG11685-MONOMER
ECOLIWIKI:
b3656
INTERPRO:
IPR017853
INTERPRO:
IPR013780
INTERPRO:
IPR000322
INTERPRO:
IPR011013
INTERPRO:
IPR025887
MODBASE:
P31434
PDB:
2F2H
PDB:
1XSK
PDB:
1XSJ
PDB:
1XSI
PDB:
1WE5
PFAM:
PF01055
PFAM:
PF13802
PRIDE:
P31434
PROSITE:
PS00129
REFSEQ:
NP_418113
SMR:
P31434
UNIPROT:
P31434


Operon      
Name: yicJI         
Operon arrangement:
Transcription unit        Promoter
yicJI


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB