RegulonDB RegulonDB 10.9: Gene Form
   

yicL gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

setC yicL nlpA yicU terminator anti-terminator anti-anti-terminator TSS_4246 TSS_4246

Gene      
Name: yicL    Texpresso search in the literature
Synonym(s): ECK3650, EG11688, b3660
Genome position(nucleotides): 3838248 --> 3839171 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
48.7
External database links:  
ASAP:
ABE-0011962
ECHOBASE:
EB1639
ECOLIHUB:
yicL
OU-MICROARRAY:
b3660
STRING:
511145.b3660
COLOMBOS: yicL


Product      
Name: putative transporter YicL
Synonym(s): YicL, putative inner membrane protein
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 33.112
Isoelectric point: 10.73
Motif(s):
 
Type Positions Sequence
16 -> 145 VLWGSSGVCAQYIMEQSQMSSQFLTMTRLIFAGLILLTLSFVHGDKIFSIINNHKDAISLLIFSVVGALTVQLTFLLTIEKSNAATATVLQFLSPTIIVAWFSLVRKSRPGILVFCAILTSLVGTFLLVT
6 -> 145 KGMLNVLIAAVLWGSSGVCAQYIMEQSQMSSQFLTMTRLIFAGLILLTLSFVHGDKIFSIINNHKDAISLLIFSVVGALTVQLTFLLTIEKSNAATATVLQFLSPTIIVAWFSLVRKSRPGILVFCAILTSLVGTFLLVT
125 -> 145 PGILVFCAILTSLVGTFLLVT
152 -> 172 LSISPAALFWGIASAFAAAFY
46 -> 66 FAGLILLTLSFVHGDKIFSII

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.3 - cofactors, small molecule carriers --> 1.5.3.12 - heme, porphyrine
  4 - transport --> 4.9.B - Putative uncharacterized transport protein
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
Note(s): Note(s): ...[more].
Reference(s): [1] Jindal S., et al., 2019
External database links:  
ECOCYC:
EG11688-MONOMER
ECOLIWIKI:
b3660
INTERPRO:
IPR000620
INTERPRO:
IPR004779
PFAM:
PF00892
PRIDE:
P31437
REFSEQ:
NP_418116
UNIPROT:
P31437


Operon      
Name: yicL         
Operon arrangement:
Transcription unit        Promoter
yicL


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4246 3838644 forward nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Jindal S., Yang L., Day PJ., Kell DB., 2019, Involvement of multiple influx and efflux transporters in the accumulation of cationic fluorescent dyes by Escherichia coli., BMC Microbiol 19(1):195

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB