RegulonDB RegulonDB 10.9: Gene Form
   

yicN gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

adeQ nepI yicN SoxS terminator yicNp4 yicNp4 TSS_4249 (cluster) TSS_4249 (cluster) nepIp nepIp

Gene      
Name: yicN    Texpresso search in the literature
Synonym(s): ECK3654, EG11690, b3663
Genome position(nucleotides): 3841950 <-- 3842402 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.76
External database links:  
ASAP:
ABE-0011972
ECHOBASE:
EB1641
ECOLIHUB:
yicN
OU-MICROARRAY:
b3663
STRING:
511145.b3663
COLOMBOS: yicN


Product      
Name: DUF1198 domain-containing protein YicN
Synonym(s): YicN
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 17.219
Isoelectric point: 7.088
Motif(s):
 
Type Positions Sequence
1 -> 142 MIWIMLATLAVVFVVGFRVLTSGARKAIRRLSDRLNIDVVPVESMVDQMGKSAGDEFLRYLHRPDESHLQNAAQVLLIWQIVIVDGSEQNLLQWHRILQKARLAAPITDAQVRLALGFLRETEPEMQDINAFQMRYNAFFQP

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG11690-MONOMER
ECOLIWIKI:
b3663
INTERPRO:
IPR009587
PFAM:
PF06711
PRIDE:
P0ADL3
REFSEQ:
NP_418119
SMR:
P0ADL3
UNIPROT:
P0ADL3


Operon      
Name: yicN         
Operon arrangement:
Transcription unit        Promoter
yicN


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4249 (cluster) 3842421 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter yicNp4 3842509 reverse Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB