RegulonDB RegulonDB 10.9: Gene Form
   

adeQ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

adeD adeQ yicN terminator yicOp1 yicOp1 adep7 adep7 yicOp10 yicOp10 adep adep adep6 adep6 yicOp5 yicOp5 yicOp11 yicOp11 yicNp4 yicNp4 TSS_4249 (cluster) TSS_4249 (cluster)

Gene      
Name: adeQ    Texpresso search in the literature
Synonym(s): ECK3655, EG11691, b3664, yicO
Genome position(nucleotides): 3842455 <-- 3843789 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
48.31
External database links:  
ASAP:
ABE-0011975
ECHOBASE:
EB1642
ECOLIHUB:
yicO
OU-MICROARRAY:
b3664
STRING:
511145.b3664
COLOMBOS: adeQ


Product      
Name: adenine transporter
Synonym(s): AdeQ, YicO
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 46.934
Isoelectric point: 5.995
Motif(s):
 
Type Positions Sequence
64 -> 82 VFVTTCLIAGIGSIAMGIF
383 -> 418 TESVPAFITTVMMPFTFSITEGIALGFMSYCIMKVC
358 -> 377 ATAGALIFVGVLMTSSLARV
146 -> 166 RIGITSGIGLFIALMGLKNTG
252 -> 280 LELAGIIFSFMLINLFDSSGTLIGVTDKA

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.2 - Electrochemical potential driven transporters --> 4.2.A - Porters (Uni-, Sym- and Antiporters)
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0015205 - nucleobase transmembrane transporter activity
GO:0022857 - transmembrane transporter activity
GO:0005345 - purine nucleobase transmembrane transporter activity
GO:0015207 - adenine transmembrane transporter activity
biological_process GO:0055085 - transmembrane transport
GO:0015853 - adenine transport
GO:1904823 - purine nucleobase transmembrane transport
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG11691-MONOMER
ECOLIWIKI:
b3664
INTERPRO:
IPR026033
INTERPRO:
IPR006043
PANTHER:
PTHR11119
PFAM:
PF00860
PRIDE:
P31440
REFSEQ:
NP_418120
UNIPROT:
P31440


Operon      
Name: adeQ         
Operon arrangement:
Transcription unit        Promoter
adeQ


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4249 (cluster) 3842421 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter yicNp4 3842509 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yicOp11 3843819 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yicOp5 3843880 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter adep6 3843901 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yicOp10 3843921 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter adep7 3843930 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yicOp1 3843957 reverse Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB