RegulonDB RegulonDB 10.9: Gene Form
   

glvG gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

Gene      
Name: glvG    Texpresso search in the literature
Synonym(s): ECK3673, EG11708, b3681, yidM
Genome position(nucleotides): 3861349 <-- 3861987 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.21
External database links:  
ASAP:
ABE-0012036
ECHOBASE:
EB1659
ECOLIHUB:
glvG
OU-MICROARRAY:
b3681
COLOMBOS: glvG


Product      
Name: putative inactive phospho-glucosidase
Synonym(s): GlvG, YidM
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 23.724
Isoelectric point: 9.297
Motif(s):
 
Type Positions Sequence
4 -> 70 FSVVVAGGGSTFTPGIVLMLLANQDRFPLRALKFYDNDGARQEVIAEACKVILKEKAPDIAFSYTTD
6 -> 184 VVVAGGGSTFTPGIVLMLLANQDRFPLRALKFYDNDGARQEVIAEACKVILKEKAPDIAFSYTTDPEVAFSDVDFVMAHIRVGKYPMRELDEKIPLRHGVVGQETCGPGGIAYGMRSIGGVLELVDYMEKYSPNAWMLNYSNPAAIVAEATRRLRPNAKILNICDMPIGIESRMAQIVG

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
Gene Ontology Terms (GO)  
molecular_function GO:0003824 - catalytic activity
GO:0046872 - metal ion binding
GO:0004553 - hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0016616 - oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
biological_process GO:0005975 - carbohydrate metabolic process
GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
External database links:  
CAZY:
GH4
DIP:
DIP-9813N
ECOCYC:
EG11708-MONOMER
ECOLIWIKI:
b3681
INTERPRO:
IPR001088
INTERPRO:
IPR036291
INTERPRO:
IPR019802
INTERPRO:
IPR015955
MODBASE:
P31450
PANTHER:
PTHR32092
PFAM:
PF02056
PRIDE:
P31450
PRINTS:
PR00732
PROSITE:
PS01324
REFSEQ:
NP_418137
SMR:
P31450
SWISSMODEL:
P31450
UNIPROT:
P31450


Operon      
Name: glvCBG-ysdC         
Operon arrangement:
Transcription unit        Promoter
glvCBG-ysdC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB