RegulonDB RegulonDB 10.9: Gene Form
   

glvB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

glvC glvG glvB ysdC yidL

Gene      
Name: glvB    Texpresso search in the literature
Synonym(s): ECK3674, EG11709, b3682, yidN, yidO
Genome position(nucleotides): 3861987 <-- 3862472 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.62
External database links:  
ASAP:
ABE-0012038
ECHOBASE:
EB1660
ECOLIHUB:
glvB
OU-MICROARRAY:
b3682
STRING:
316407.85676362
COLOMBOS: glvB


Product      
Name: putative PTS enzyme II component GlvB
Synonym(s): GlvB, YidN, YidO
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 17.626
Isoelectric point: 6.338
Motif(s):
 
Type Positions Sequence
76 -> 105 ILQALGGVGNISSINNCATRLRIALHDMSQ
10 -> 32 LTQIAIGLCFTLLYFVVFRTLIL
70 -> 152 LDQAAGILQALGGVGNISSINNCATRLRIALHDMSQTLDDEVFKKLGAHGVFRSGDAIQVIIGLHVSQLREQLDSLINSHQSA

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.4 - Group Translocators --> 4.4.A - Phosphotransferase Systems (PEP-dependent PTS)
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0016740 - transferase activity
GO:0016301 - kinase activity
GO:0008982 - protein-N(PI)-phosphohistidine-sugar phosphotransferase activity
biological_process GO:0008643 - carbohydrate transport
GO:0009401 - phosphoenolpyruvate-dependent sugar phosphotransferase system
GO:0016310 - phosphorylation
GO:0034219 - carbohydrate transmembrane transport
Note(s): Note(s): ...[more].
Evidence: [ISA] Inferred from Sequence Alignment
Reference(s): [1] Kricker M., et al., 1987
[2] Reizer J., et al., 1994
External database links:  
ECOCYC:
GLVB-MONOMER
ECOLIWIKI:
b3682
INTERPRO:
IPR001996
INTERPRO:
IPR036878
INTERPRO:
IPR018113
MODBASE:
P69789
PFAM:
PF00367
PRIDE:
P69789
PROSITE:
PS01035
PROSITE:
PS51098
REFSEQ:
YP_026235
SMR:
P69789
UNIPROT:
P69789


Operon      
Name: glvCBG-ysdC         
Operon arrangement:
Transcription unit        Promoter
glvCBG-ysdC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Kricker M., Hall BG., 1987, Biochemical genetics of the cryptic gene system for cellobiose utilization in Escherichia coli K12., Genetics 115(3):419-29

 [2] Reizer J., Michotey V., Reizer A., Saier MH., 1994, Novel phosphotransferase system genes revealed by bacterial genome analysis: unique, putative fructose- and glucoside-specific systems., Protein Sci 3(3):440-50


RegulonDB