RegulonDB RegulonDB 10.9: Gene Form
   

glvC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

glvC yidP glvB yidE

Gene      
Name: glvC    Texpresso search in the literature
Synonym(s): ECK3675, EG11710, b3683, ptiC
Genome position(nucleotides): 3862497 <-- 3863603 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.85
External database links:  
ASAP:
ABE-0012043
ECHOBASE:
EB1661
ECOLIHUB:
glvC
OU-MICROARRAY:
b3683
STRING:
316407.85676361
COLOMBOS: glvC


Product      
Name: putative PTS enzyme II component GlvC
Synonym(s): GlvC, PtiC
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 39.692
Isoelectric point: 6.62
Motif(s):
 
Type Positions Sequence
1 -> 368 MLSQIQRFGGAMFTPVLLFPFAGIVVGLAILLQNPMFVGESLTDPNSLFAQIVHIIEEGGWTVFRNMPLIFAVGLPIGLAKQAQGRACLAVMVSFLTWNYFINAMGMTWGSYFGVDFTQDAVAGSGLTMMAGIKTLDTSIIGAIIISGIVTALHNRLFDKKLPVFLGIFQGTSYVVIIAFLVMIPCAWLTLLGWPKVQMGIESLQAFLRSAGALGVWVYTFLERILIPTGLHHFIYGQFIFGPAAVEGGIQMYWAQHLQEFSLSAEPLKSLFPEGGFALHGNSKIFGAVGISLAMYFTAAPENRVKVAGLLIPATLTAMLVGITEPLEFTFLFISPLLFAVHAVLAASMSTVMYLFGVVGNMGGGLID
87 -> 107 ACLAVMVSFLTWNYFINAMGM
10 -> 346 GAMFTPVLLFPFAGIVVGLAILLQNPMFVGESLTDPNSLFAQIVHIIEEGGWTVFRNMPLIFAVGLPIGLAKQAQGRACLAVMVSFLTWNYFINAMGMTWGSYFGVDFTQDAVAGSGLTMMAGIKTLDTSIIGAIIISGIVTALHNRLFDKKLPVFLGIFQGTSYVVIIAFLVMIPCAWLTLLGWPKVQMGIESLQAFLRSAGALGVWVYTFLERILIPTGLHHFIYGQFIFGPAAVEGGIQMYWAQHLQEFSLSAEPLKSLFPEGGFALHGNSKIFGAVGISLAMYFTAAPENRVKVAGLLIPATLTAMLVGITEPLEFTFLFISPLLFAVHAVLA
277 -> 297 FALHGNSKIFGAVGISLAMYF
12 -> 32 MFTPVLLFPFAGIVVGLAILL

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.4 - Group Translocators --> 4.4.A - Phosphotransferase Systems (PEP-dependent PTS)
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0008982 - protein-N(PI)-phosphohistidine-sugar phosphotransferase activity
GO:0090563 - protein-phosphocysteine-sugar phosphotransferase activity
biological_process GO:0008643 - carbohydrate transport
GO:0009401 - phosphoenolpyruvate-dependent sugar phosphotransferase system
GO:0034219 - carbohydrate transmembrane transport
Note(s): Note(s): ...[more].
Evidence: [ISA] Inferred from Sequence Alignment
Reference(s): [1] Kricker M., et al., 1987
[2] Reizer J., et al., 1994
[3] Wolfe AJ. 2005
External database links:  
ECOCYC:
GLVC-MONOMER
ECOLIWIKI:
b3683
INTERPRO:
IPR004719
INTERPRO:
IPR013013
INTERPRO:
IPR010975
INTERPRO:
IPR003352
PFAM:
PF02378
PRIDE:
P31452
PROSITE:
PS51103
REFSEQ:
YP_026236
UNIPROT:
P31452


Operon      
Name: glvCBG-ysdC         
Operon arrangement:
Transcription unit        Promoter
glvCBG-ysdC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Kricker M., Hall BG., 1987, Biochemical genetics of the cryptic gene system for cellobiose utilization in Escherichia coli K12., Genetics 115(3):419-29

 [2] Reizer J., Michotey V., Reizer A., Saier MH., 1994, Novel phosphotransferase system genes revealed by bacterial genome analysis: unique, putative fructose- and glucoside-specific systems., Protein Sci 3(3):440-50

 [3] Wolfe AJ., 2005, The acetate switch., Microbiol Mol Biol Rev 69(1):12-50


RegulonDB