RegulonDB RegulonDB 10.9: Gene Form
   

yidP gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yidE glvC yidP ibpB terminator yidEp6 yidEp6

Gene      
Name: yidP    Texpresso search in the literature
Synonym(s): ECK3676, EG11711, b3684
Genome position(nucleotides): 3863899 --> 3864615 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.32
External database links:  
ASAP:
ABE-0012049
ECHOBASE:
EB1662
ECOLIHUB:
yidP
OU-MICROARRAY:
b3684
STRING:
511145.b3684
COLOMBOS: yidP


Product      
Name: putative DNA-binding transcriptional regulator YidP
Synonym(s): YidP
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 27.328
Isoelectric point: 9.882
Motif(s):
 
Type Positions Sequence
3 -> 64 YKSIAERLRIRLNSADFTLNSLLPGEKKLAEEFAVSRMTIRKAIDLLVAWGLVVRRHGSGTY
1 -> 68 MIYKSIAERLRIRLNSADFTLNSLLPGEKKLAEEFAVSRMTIRKAIDLLVAWGLVVRRHGSGTYLVRK
87 -> 224 QGKTVTSQVLIFEIMPAPPAIASQLRIQINEQIYFSRRVRFVEGKPLMLEDSYMPVKLFRNLSLQHLEGSKFEYIEQECGILIGGNYESLTPVLADRLLARQMKVAEHTPLLRITSLSYSESGEFLNYSVMFRNASEY
28 -> 47 EKKLAEEFAVSRMTIRKAID

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.3 - repressor
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0003700 - DNA-binding transcription factor activity
biological_process GO:0006351 - transcription, DNA-templated
GO:0006355 - regulation of transcription, DNA-templated
GO:0045892 - negative regulation of transcription, DNA-templated
Note(s): Note(s): ...[more].
Evidence: [HIFS] Human inference of function from sequence
Reference(s): [1] Paradis-Bleau C., et al., 2014
[2] Perez-Rueda E., et al., 2000
[3] Perez-Rueda E., et al., 2004
External database links:  
ECOCYC:
EG11711-MONOMER
ECOLIWIKI:
b3684
INTERPRO:
IPR000524
INTERPRO:
IPR036390
INTERPRO:
IPR036388
INTERPRO:
IPR028978
INTERPRO:
IPR011663
MODBASE:
P31453
PFAM:
PF07702
PFAM:
PF00392
PRIDE:
P31453
PRINTS:
PR00035
PROSITE:
PS50949
REFSEQ:
NP_418139
SMART:
SM00345
SMART:
SM00866
SMR:
P31453
UNIPROT:
P31453


Operon      
Name: yidP         
Operon arrangement:
Transcription unit        Promoter
yidP


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yidEp6 3866390 reverse Similarity to the consensus
Read more >
[ICWHO] [4]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Paradis-Bleau C., Kritikos G., Orlova K., Typas A., Bernhardt TG., 2014, A genome-wide screen for bacterial envelope biogenesis mutants identifies a novel factor involved in cell wall precursor metabolism., PLoS Genet 10(1):e1004056

 [2] Perez-Rueda E., Collado-Vides J., 2000, The repertoire of DNA-binding transcriptional regulators in Escherichia coli K-12., Nucleic Acids Res 28(8):1838-47

 [3] Perez-Rueda E., Collado-Vides J., Segovia L., 2004, Phylogenetic distribution of DNA-binding transcription factors in bacteria and archaea., Comput Biol Chem 28(5-6):341-50

 [4] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB