RegulonDB RegulonDB 10.9: Gene Form
   

yieF gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

adeP yieE yieF TSS_4280 TSS_4280

Gene      
Name: yieF    Texpresso search in the literature
Synonym(s): ECK3706, EG11723, b3713, chrR
Genome position(nucleotides): 3894652 --> 3895218 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.73
External database links:  
ASAP:
ABE-0012146
ECHOBASE:
EB1674
ECOLIHUB:
yieF
OU-MICROARRAY:
b3713
STRING:
511145.b3713
COLOMBOS: yieF


Product      
Name: chromate reductase
Synonym(s): ChrR, YieF
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 20.376
Isoelectric point: 4.762
Motif(s):
 
Type Positions Sequence
82 -> 85 EYNY
13 -> 20 SLRKGSFN
6 -> 148 QVVTLLGSLRKGSFNGMVARTLPKIAPASMEVNALPSIADIPLYDADVQQEEGFPATVEALAEQIRQADGVVIVTPEYNYSVPGGLKNAIDWLSRLPDQPLAGKPVLIQTSSMGVIGGARCQYHLRQILVFLDAMVMNKPEFM
146 -> 146 E
128 -> 128 Y

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.6 - protection --> 5.6.2 - detoxification
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016491 - oxidoreductase activity
GO:0003955 - NAD(P)H dehydrogenase (quinone) activity
GO:0010181 - FMN binding
biological_process GO:0006805 - xenobiotic metabolic process
GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-36041N
ECOCYC:
EG11723-MONOMER
ECOLIWIKI:
b3713
INTERPRO:
IPR005025
INTERPRO:
IPR029039
MODBASE:
P0AGE6
PDB:
3SVL
PFAM:
PF03358
PRIDE:
P0AGE6
REFSEQ:
NP_418169
SMR:
P0AGE6
SWISSMODEL:
P0AGE6
UNIPROT:
P0AGE6


Operon      
Name: yieEF         
Operon arrangement:
Transcription unit        Promoter
yieEF


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4280 3896456 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB