RegulonDB RegulonDB 10.9: Gene Form
   

pqqL gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

pqqL yddB gadB GadX GadX GadW GadX GadW GadX GadX GadW Fis GadX GadW RcsB CRP GadE Fis GadX Fis GadX Fis TSS_1835 TSS_1835 gadBp gadBp TSS_1834 TSS_1834

Gene      
Name: pqqL    Texpresso search in the literature
Synonym(s): ECK1488, EG11744, b1494, pqqE, pqqM, yddC
Genome position(nucleotides): 1572407 <-- 1575202 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
46.64
External database links:  
ASAP:
ABE-0004979
CGSC:
35854
ECHOBASE:
EB1695
ECOLIHUB:
pqqL
OU-MICROARRAY:
b1494
STRING:
511145.b1494
COLOMBOS: pqqL


Product      
Name: periplasmic metalloprotease
Synonym(s): PqqE, PqqL, PqqM, YddC
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space,cytosol
Molecular weight: 104.656
Isoelectric point: 6.237
Motif(s):
 
Type Positions Sequence
207 -> 386 VTPAQLRQFYQRWYQPNNMTFIVVGDIDSKEALALIKDNLSKLPANKAAENRVWPTKAENHLRFNIINDKENRVNGIALYYRLPMVQVNDEQSFIEQAEWSMLVQLFNQRLQERIQSGELKTISGGTARSVKIAPDYQSLFFRVNARDDNMQDAANALMAELATIDQHGFSAEELDDVKS
1 -> 26 MEIIMRNLCFLLTLVATLLLPGRLIA
360 -> 360 A
46 -> 203 YMIYPHAHPKDQVNLWLQIHTGSLQEEDNELGVAHFVEHMMFNGTKTWPGNKVIETFESMGLRFGRDVNAYTSYDETVYQVSLPTTQKQNLQQVMAIFSEWSNAATFEKLEVDAERGVITEEWRAHQDAKWRTSQARRPFLLANTRNLDREPIGLMDT
697 -> 862 FSSPADITFVIVGNVAEDKLVALITRYLGSIKHSDSPLAAGKPLTRATDNASVTVKEQNEPVAQVSQWKRYDSRTPVNLPTRMALDAFNVALAKDLRVNIREQASGAYSVSSRLSVDPQAKDISHLLAFTCQPERHDELLTLANEVMVKRLAKGISEQELNEYQQN

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0030288 - outer membrane-bounded periplasmic space
molecular_function GO:0008233 - peptidase activity
GO:0016787 - hydrolase activity
GO:0046872 - metal ion binding
GO:0008270 - zinc ion binding
GO:0008237 - metallopeptidase activity
biological_process GO:0006508 - proteolysis
Note(s): Note(s): ...[more].
Evidence: [APPH] Assay of protein purified to homogeneity
Reference(s): [1] Grinter R., et al., 2019
[2] Xiong X., et al., 2010
External database links:  
DIP:
DIP-10556N
ECOCYC:
EG11744-MONOMER
ECOLIWIKI:
b1494
INTERPRO:
IPR007863
INTERPRO:
IPR011765
INTERPRO:
IPR011249
INTERPRO:
IPR001431
MODBASE:
P31828
PDB:
6OFT
PDB:
6OFS
PFAM:
PF00675
PFAM:
PF05193
PRIDE:
P31828
PROSITE:
PS00143
REFSEQ:
NP_416011
SMR:
P31828
UNIPROT:
P31828


Operon      
Name: pqqL         
Operon arrangement:
Transcription unit        Promoter
pqqL


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1834 1571620 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_1835 1572073 reverse nd [RS-EPT-CBR] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Grinter R., Leung PM., Wijeyewickrema LC., Littler D., Beckham S., Pike RN., Walker D., Greening C., Lithgow T., 2019, Protease-associated import systems are widespread in Gram-negative bacteria., PLoS Genet 15(10):e1008435

 [2] Xiong X., Yang L., Han X., Wang J., Zhang W., 2010, [Knockout and function analysis of pqqL gene in Escherichia coli]., Wei Sheng Wu Xue Bao 50(10):1380-4

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB