RegulonDB RegulonDB 10.8: Gene Form
   

yibG gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yibA yibJ yibG yibW yibV yibS yibGp6 yibGp6 TSS_4177 TSS_4177

Gene      
Name: yibG    Texpresso search in the literature
Synonym(s): ECK3585, EG11763, b3596
Genome position(nucleotides): 3768177 --> 3768638 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
32.25
External database links:  
ASAP:
ABE-0011750
ECHOBASE:
EB1713
OU-MICROARRAY:
b3596
PortEco:
yibG
STRING:
511145.b3596
COLOMBOS: yibG


Product      
Name: tetratricopeptide-like domain-containing protein YibG
Synonym(s): YibG
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 18.079
Isoelectric point: 9.692
Motif(s):
 
Type Positions Sequence
1 -> 19 MKACLLLFFYFSFICQLHG
20 -> 153 ADVKIKQNESMMGSTAMTYDLSEEKLMKLKYKSQHGDSEASFRLYQYYCFTKNNIYKQLRFLERSASQGNVTAQFNYGVFLSDTNPTLSEYYNLNRAIYWMEFAVNNGNIDAKSKLQELKKLKRMDRRKNKENP

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG11763-MONOMER
ECOLIWIKI:
b3596
INTERPRO:
IPR011990
PRIDE:
P32106
REFSEQ:
NP_418053
SMR:
P32106
UNIPROT:
P32106


Operon      
Name: yibG         
Operon arrangement:
Transcription unit        Promoter
 


Regulation by small RNA    
  Display Regulation
small RNA gcvB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4177 3767698 forward nd [RS-EPT-CBR] [1]
  promoter yibGp6 3768064 forward Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB