RegulonDB RegulonDB 10.9: Gene Form
   

ybbC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

rhsD ylbH ybbD ylbG ybbC ylbI TSS_665 TSS_665

Gene      
Name: ybbC    Texpresso search in the literature
Synonym(s): ECK0492, EG11769, b0498
Genome position(nucleotides): 527581 --> 527949 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
30.62
External database links:  
ASAP:
ABE-0001726
ECHOBASE:
EB1719
ECOLIHUB:
ybbC
OU-MICROARRAY:
b0498
STRING:
511145.b0498
COLOMBOS: ybbC


Product      
Name: PF15631 family protein YbbC
Synonym(s): YbbC
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 14.152
Isoelectric point: 5.766
Motif(s):
 
Type Positions Sequence
18 -> 122 CNETAVYGSDENIIFMRYVEKLHLDKYSVKNTVKTETMAIQLAEIYVRYRYGERIAEEEKPYLITELPDSWVVEGAKLPYEVAGGVFIIEINKKNGCVLNFLHSK
1 -> 17 MKYSSIFSMLSFFILFA
55 -> 122 MAIQLAEIYVRYRYGERIAEEEKPYLITELPDSWVVEGAKLPYEVAGGVFIIEINKKNGCVLNFLHSK

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-11316N
ECOCYC:
EG11769-MONOMER
ECOLIWIKI:
b0498
INTERPRO:
IPR028921
PFAM:
PF15631
PRIDE:
P33668
PROSITE:
PS51257
REFSEQ:
NP_415031
SMR:
P33668
UNIPROT:
P33668


Operon      
Name: rhsD-ybbC-ylbH-ybbD         
Operon arrangement:
Transcription unit        Promoter
rhsD-ybbC-ylbH-ybbD


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_665 526934 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB