RegulonDB RegulonDB 10.10: Gene Form
   

trmB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

mutY trmB yggN yggL anti-anti-terminator anti-terminator terminator TSS_3294 TSS_3294 yggXp yggXp mutYp1 mutYp1 mutYp2 mutYp2 TSS_3292 TSS_3292 TSS_3291 TSS_3291 TSS_3290 TSS_3290 yggLp3 yggLp3 yggLp2 yggLp2 TSS_3288 TSS_3288 TSS_3287 (cluster) TSS_3287 (cluster) TSS_3286 (cluster) TSS_3286 (cluster) TSS_3285 (cluster) TSS_3285 (cluster) TSS_3284 TSS_3284 yggNp1 yggNp1 yggNp2 yggNp2 yggNp2b yggNp2b TSS_3283 TSS_3283

Gene      
Name: trmB    Texpresso search in the literature
Synonym(s): ECK2955, EG11779, b2960, trmI, yggH
Genome position(nucleotides): 3102133 <-- 3102852 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.64
External database links:  
ASAP:
ABE-0009714
ECHOBASE:
EB1727
ECOLIHUB:
trmI
OU-MICROARRAY:
b2960
STRING:
511145.b2960
COLOMBOS: trmB


Product      
Name: tRNA m7G46 methyltransferase
Synonym(s): TrmB, TrmI, YggH
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 27.307
Isoelectric point: 6.912
Motif(s):
 
Type Positions Sequence
64 -> 233 APVTLEIGFGMGASLVAMAKDRPEQDFLGIEVHSPGVGACLASAHEEGLSNLRVMCHDAVEVLHKMIPDNSLRMVQLFFPDPWHKARHNKRRIVQVPFAELVKSKLQLGGVFHMATDWEPYAEHMLEVMSSIDGYKNLSESNDYVPRPASRPVTKFEQRGHRLGHGVWDL
150 -> 150 R
220 -> 220 E
154 -> 154 R
26 -> 26 R

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.3 - RNA modification
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0043527 - tRNA methyltransferase complex
molecular_function GO:0008168 - methyltransferase activity
GO:0016740 - transferase activity
GO:0008176 - tRNA (guanine-N7-)-methyltransferase activity
biological_process GO:0106004 - tRNA (guanine-N7)-methylation
GO:0006400 - tRNA modification
GO:0030488 - tRNA methylation
GO:0008033 - tRNA processing
GO:0032259 - methylation
GO:0036265 - RNA (guanine-N7)-methylation
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-36015N
ECOCYC:
EG11779-MONOMER
ECOLIWIKI:
b2960
INTERPRO:
IPR003358
INTERPRO:
IPR029063
MODBASE:
P0A8I5
PANTHER:
PTHR23417
PDB:
3DXX
PDB:
3DXZ
PDB:
3DXY
PFAM:
PF02390
PRIDE:
P0A8I5
PROSITE:
PS51625
REFSEQ:
NP_417435
SMR:
P0A8I5
UNIPROT:
P0A8I5


Operon      
Name: trmB-yggL         
Operon arrangement:
Transcription unit        Promoter
trmB-yggL


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3283 3101055 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3284 3102157 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3285 (cluster) 3102193 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3286 (cluster) 3102200 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3287 (cluster) 3102236 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3288 3102247 reverse nd [RS-EPT-CBR] [1]
  promoter yggLp2 3102250 reverse nd [ICWHO], [RS-EPT-CBR] [1], [2]
  promoter yggLp3 3102254 reverse nd [ICWHO] [2]
  promoter TSS_3290 3102279 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3291 3102291 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3292 3102390 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3294 3104042 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB