RegulonDB RegulonDB 10.8: Gene Form
   

wcaI gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

cpsB wcaI fcl gmm

Gene      
Name: wcaI    Texpresso search in the literature
Synonym(s): ECK2044, EG11790, b2050, yefD
Genome position(nucleotides): 2124523 <-- 2125746 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.56
External database links:  
ASAP:
ABE-0006794
ECHOBASE:
EB1738
OU-MICROARRAY:
b2050
PortEco:
wcaI
STRING:
511145.b2050
COLOMBOS: wcaI


Product      
Name: colanic acid biosynthesis fucosyltransferase WcaI
Synonym(s): WcaI, YefD
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 44.914
Isoelectric point: 8.843
Motif(s):
 
Type Positions Sequence
219 -> 389 DALRNQLDLPDNKKIILYSGNIGEKQGLENVIEAADRLRDEPLIFAIVGQGGGKARLEKMAQQRGLRNMQFFPLQSYDALPALLKMGDCHLVVQKRGAADAVLPSKLTNILAVGGNAVITAEAYTELGQLCETFPGIAVCVEPESVEALVAGIRQALLLPKHNTVAREYAE
15 -> 204 TGIGKYTGEMVEWLAAQGHEVRVITAPPYYPQWQVGENYSAWRYKREEGAATVWRCPLYVPKQPSTLKRLLHLGSFAVSSFFPLMAQRRWKPDRIIGVVPTLFCAPGMRLLAKLSGARTVLHIQDYEVDAMLGLGLAGKGKGGKVAQLATAFERSGLHNVDNVSTISRSMMNKAIEKGVAAENVIFFPNW

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.2 - colanic acid (M antigen)
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0046920 - alpha-(1->3)-fucosyltransferase activity
GO:0016757 - transferase activity, transferring glycosyl groups
GO:0016740 - transferase activity
biological_process GO:0009103 - lipopolysaccharide biosynthetic process
GO:0009242 - colanic acid biosynthetic process
GO:0045228 - slime layer polysaccharide biosynthetic process
Note(s): Note(s): ...[more].
External database links:  
CAZY:
GT4
DIP:
DIP-11124N
ECOCYC:
EG11790-MONOMER
ECOLIWIKI:
b2050
INTERPRO:
IPR001296
INTERPRO:
IPR028098
INTERPRO:
IPR023910
MINT:
MINT-1309672
MODBASE:
P32057
PFAM:
PF13579
PFAM:
PF00534
PRIDE:
P32057
REFSEQ:
NP_416554
SMR:
P32057
UNIPROT:
P32057


Operon      
Name: wcaCDEF-gmd-fcl-gmm-wcaI-cpsBG-wcaJ-wzxC         
Operon arrangement:
Transcription unit        Promoter
wcaCDEF-gmd-fcl-gmm-wcaI-cpsBG-wcaJ-wzxC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB