RegulonDB RegulonDB 10.8: Gene Form
   

talA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

maeB tktB talA CreB anti-anti-terminator anti-terminator terminator tktBp tktBp TSS_2750 TSS_2750 talAp talAp talAp1 talAp1 talAp2 talAp2 TSS_2749 TSS_2749

Gene      
Name: talA    Texpresso search in the literature
Synonym(s): ECK2459, EG11797, b2464
Genome position(nucleotides): 2578666 --> 2579616 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.26
External database links:  
ASAP:
ABE-0008115
ECHOBASE:
EB1745
OU-MICROARRAY:
b2464
PortEco:
talA
STRING:
511145.b2464
COLOMBOS: talA


Product      
Name: transaldolase A
Synonym(s): TalA
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 35.659
Isoelectric point: 6.186
Motif(s):
 
Type Positions Sequence
13 -> 310 VVADSGDIESIRHYHPQDATTNPSLLLKAAGLSQYEHLIDDAIAWGKKNGKTQEQQVVAACDKLAVNFGAEILKIVPGRVSTEVDARLSFDKEKSIEKARHLVDLYQQQGVEKSRILIKLASTWEGIRAAEELEKEGINCNLTLLFSFAQARACAEAGVFLISPFVGRIYDWYQARKPMDPYVVEEDPGVKSVRNIYDYYKQHHYETIVMGASFRRTEQILALTGCDRLTIAPNLLKELQEKVSPVVRKLIPPSQTFPRPAPMSEAEFRWEHNQDAMAVEKLSEGIRLFAVDQRKLED

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.3 - non-oxidative branch, pentose pathway
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0016740 - transferase activity
GO:0004801 - sedoheptulose-7-phosphate:D-glyceraldehyde-3-phosphate glyceronetransferase activity
biological_process GO:0005975 - carbohydrate metabolic process
GO:0006098 - pentose-phosphate shunt
Note(s): Note(s): ...[more].
Reference(s): [1] Gu Y., et al., 2009
[2] Song BG., et al., 2006
[3] Tao H., et al., 2001
External database links:  
DIP:
DIP-47872N
ECOCYC:
TRANSALDOLA-MONOMER
ECOLIWIKI:
b2464
INTERPRO:
IPR001585
INTERPRO:
IPR018225
INTERPRO:
IPR013785
INTERPRO:
IPR004730
MODBASE:
P0A867
PANTHER:
PTHR10683
PFAM:
PF00923
PRIDE:
P0A867
PRODB:
PRO_000024022
PROSITE:
PS01054
PROSITE:
PS00958
REFSEQ:
NP_416959
SMR:
P0A867
SWISSMODEL:
P0A867
UNIPROT:
P0A867


Operon      
Name: talA-tktB         
Operon arrangement:
Transcription unit        Promoter
talA-tktB
talA-tktB
talA
tktB


Transcriptional Regulation      
Display Regulation             
Activated by: CreB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2749 2578531 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_2750 2578793 reverse nd [RS-EPT-CBR] [4]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Gu Y., Li J., Zhang L., Chen J., Niu L., Yang Y., Yang S., Jiang W., 2009, Improvement of xylose utilization in Clostridium acetobutylicum via expression of the talA gene encoding transaldolase from Escherichia coli., J Biotechnol 143(4):284-7

 [2] Song BG., Kim TK., Jung YM., Lee YH., 2006, Modulation of talA gene in pentose phosphate pathway for overproduction of poly-beta-hydroxybutyrate in transformant Escherichia coli harboring phbCAB operon., J Biosci Bioeng 102(3):237-40

 [3] Tao H., Gonzalez R., Martinez A., Rodriguez M., Ingram LO., Preston JF., Shanmugam KT., 2001, Engineering a homo-ethanol pathway in Escherichia coli: increased glycolytic flux and levels of expression of glycolytic genes during xylose fermentation., J Bacteriol 183(10):2979-88

 [4] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB