RegulonDB RegulonDB 10.9: Gene Form
   

hofC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

hofB hofC guaC ppdD b0105

Gene      
Name: hofC    Texpresso search in the literature
Synonym(s): ECK0105, EG11798, b0106, hopC, yacD
Genome position(nucleotides): 114522 <-- 115724 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.95
External database links:  
ASAP:
ABE-0000366
ECHOBASE:
EB1746
ECOLIHUB:
hofC
OU-MICROARRAY:
b0106
STRING:
511145.b0106
COLOMBOS: hofC


Product      
Name: inner membrane protein HofC
Synonym(s): HofC, HopC, YacD
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 44.45
Isoelectric point: 8.346
Motif(s):
 
Type Positions Sequence
165 -> 185 YPIIILAMAIMVVVAMLHFVL
1 -> 39 MASKQLWRWHGITGDGNAQDGMLWAESRTLLLMALQQQM
370 -> 390 LLIITGGIIGTLVVAMYLPIF
209 -> 229 LADFSGEWSWLLVLFGFLLAI
64 -> 186 IHQLATLLKAGLTLSEGLALLAEQHPSKQWQALLQSLAHDLEQGIAFSNALLPWSEVFPPLYQAMIRTGELTGKLDECCFELARQQKAQRQLTDKVKSALRYPIIILAMAIMVVVAMLHFVLP

 

Classification:
Multifun Terms (GenProtEC)  
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
biological_process GO:0009306 - protein secretion
GO:0015628 - protein secretion by the type II secretion system
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG11798-MONOMER
ECOLIWIKI:
b0106
INTERPRO:
IPR018076
INTERPRO:
IPR042094
INTERPRO:
IPR003004
INTERPRO:
IPR001992
PANTHER:
PTHR30012
PFAM:
PF00482
PRIDE:
P36646
PRINTS:
PR00812
PRODB:
PRO_000022911
PROSITE:
PS00874
REFSEQ:
NP_414648
UNIPROT:
P36646


Operon      
Name: ppdD-hofBC         
Operon arrangement:
Transcription unit        Promoter
ppdD-hofBC


Transcriptional Regulation      
Display Regulation             
Activated by: CRP


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB