RegulonDB RegulonDB 11.0: Gene Form

hybA gene in Escherichia coli K-12 genome

Gene local context to scale (view description)

hybC hybB hybO hybA TSS_3309 (cluster) TSS_3309 (cluster) TSS_3308 TSS_3308 TSS_3307 TSS_3307 TSS_3306 TSS_3306

Name: hybA    Texpresso search in the literature
Synonym(s): ECK2990, EG11799, b2996, hydL
Genome position(nucleotides): 3144154 <-- 3145140
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
External database links:  

Name: hydrogenase 2 iron-sulfur protein
Synonym(s): HybA, HydL
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane,periplasmic space
Molecular weight: 36.003
Isoelectric point: 7.38
Type Positions Sequence Comment
1 -> 27 MNRRNFIKAASCGALLTGALPSVSHAA UniProt: Tat-type signal.
38 -> 68 LGMLYDSTLCVGCQACVTKCQDINFPERNPQ UniProt: 4Fe-4S ferredoxin-type 1.
47 -> 58 CVGCQACVTKCQ predicted [4Fe-4S] binding domain
103 -> 134 NGYAYIKKQCMHCVDPNCVSVCPVSALKKDPK UniProt: 4Fe-4S ferredoxin-type 2.


Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.4 - energy production/transport --> 1.4.1 - electron donors
Gene Ontology Terms (GO)  
cellular_component GO:0042597 - periplasmic space
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0044569 - [Ni-Fe] hydrogenase complex
molecular_function GO:0046872 - metal ion binding
GO:0016491 - oxidoreductase activity
GO:0051536 - iron-sulfur cluster binding
GO:0051539 - 4 iron, 4 sulfur cluster binding
GO:0033748 - hydrogenase (acceptor) activity
GO:0047067 - hydrogen:quinone oxidoreductase activity
biological_process GO:0009061 - anaerobic respiration
GO:0019645 - anaerobic electron transport chain
GO:0019588 - anaerobic glycerol catabolic process
Note(s): Note(s): ...[more].
External database links:  

Name: hybOABCDEFG         
Operon arrangement:
Transcription unit        Promoter

Transcriptional Regulation      
Display Regulation             
Repressed by: NarL, ArcA

Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3306 3141794 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3307 3144533 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3308 3145033 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3309 (cluster) 3145041 reverse nd [RS-EPT-CBR] [1]


 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates


 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.
