RegulonDB RegulonDB 10.9: Gene Form
   

hybG gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yghU hybF hybG hybE

Gene      
Name: hybG    Texpresso search in the literature
Synonym(s): ECK2984, EG11805, b2990
Genome position(nucleotides): 3139716 <-- 3139964 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.21
External database links:  
ASAP:
ABE-0009816
CGSC:
33403
ECHOBASE:
EB1753
ECOLIHUB:
hybG
OU-MICROARRAY:
b2990
STRING:
511145.b2990
COLOMBOS: hybG


Product      
Name: hydrogenase maturation factor HybG
Synonym(s): HybG, hydrogenase 2 accessory protein
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 8.808
Isoelectric point: 3.948
Motif(s):
 
Type Positions Sequence
1 -> 72 MCIGVPGQVLAVGEDIHQLAQVEVCGIKRDVNIALICEGNPADLLGQWVLVHVGFAMSIIDEDEAKATLDAL

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.7 - anaerobic respiration
  2 - information transfer --> 2.3 - protein related --> 2.3.4 - chaperoning, repair (refolding)
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0005506 - iron ion binding
GO:0042802 - identical protein binding
GO:1902670 - carbon dioxide binding
biological_process GO:0051604 - protein maturation
Note(s): Note(s): ...[more].
Evidence: [IMP] Inferred from mutant phenotype
Reference(s): [1] Blokesch M., et al., 2001
[2] Hartwig S., et al., 2015
[3] Pinske C., et al., 2019
[4] Thomas C., et al., 2015
External database links:  
DIP:
DIP-36429N
ECOCYC:
EG11805-MONOMER
ECOLIWIKI:
b2990
INTERPRO:
IPR001109
INTERPRO:
IPR019812
INTERPRO:
IPR037254
PANTHER:
PTHR35177
PFAM:
PF01455
PRIDE:
P0AAM7
PRINTS:
PR00445
PRODB:
PRO_000022952
PROSITE:
PS01097
REFSEQ:
NP_417464
SMR:
P0AAM7
UNIPROT:
P0AAM7


Operon      
Name: hybOABCDEFG         
Operon arrangement:
Transcription unit        Promoter
hybOABCDEFG


Transcriptional Regulation      
Display Regulation             
Repressed by: ArcA, NarL


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Blokesch M., Magalon A., Bock A., 2001, Interplay between the specific chaperone-like proteins HybG and HypC in maturation of hydrogenases 1, 2, and 3 from Escherichia coli., J Bacteriol 183(9):2817-22

 [2] Hartwig S., Thomas C., Krumova N., Quitzke V., Turkowsky D., Jehmlich N., Adrian L., Sawers RG., 2015, Heterologous complementation studies in Escherichia coli with the Hyp accessory protein machinery from Chloroflexi provide insight into [NiFe]-hydrogenase large subunit recognition by the HypC protein family., Microbiology 161(11):2204-19

 [3] Pinske C., Thomas C., Nutschan K., Sawers RG., 2019, Delimiting the Function of the C-Terminal Extension of the Escherichia coli [NiFe]-Hydrogenase 2 Large Subunit Precursor., Front Microbiol 10:2223

 [4] Thomas C., Muhr E., Sawers RG., 2015, Coordination of Synthesis and Assembly of a Modular Membrane-Associated [NiFe]-Hydrogenase Is Determined by Cleavage of the C-Terminal Peptide., J Bacteriol 197(18):2989-98


RegulonDB