RegulonDB RegulonDB 10.9: Gene Form
   

yebG gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

purT yebF yebG PurR LexA anti-anti-terminator anti-terminator terminator TSS_2190 TSS_2190 purTp purTp purTp3 purTp3 yebGp yebGp purTp5 purTp5 TSS_2189 (cluster) TSS_2189 (cluster)

Gene      
Name: yebG    Texpresso search in the literature
Synonym(s): ECK1849, EG11808, b1848
Genome position(nucleotides): 1930457 <-- 1930747 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.48
External database links:  
ASAP:
ABE-0006145
ECHOBASE:
EB1756
ECOLIHUB:
yebG
OU-MICROARRAY:
b1848
STRING:
511145.b1848
COLOMBOS: yebG


Product      
Name: DNA damage-inducible protein YebG
Synonym(s): YebG
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 10.717
Isoelectric point: 4.088
Motif(s):
 
Type Positions Sequence
1 -> 74 MAVEVKYVVIREGEEKMSFTSKKEADAYDKMLDTADLLDTWLTNSPVQMEDEQREALSLWLAEQKDVLSTILKT

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.1 - DNA related --> 2.1.4 - DNA repair
  5 - cell processes --> 5.8 - SOS response
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
biological_process GO:0010165 - response to X-ray
GO:0006281 - DNA repair
GO:0009432 - SOS response
Note(s): Note(s): ...[more].
Evidence: [IEP] Inferred from expression pattern
Reference(s): [1] Benitez-Bellon E., et al., 2002
[2] Faith JJ., et al., 2007
[3] Khanin R., et al., 2006
[4] Lomba MR., et al., 1997
[5] Muenter MM., et al., 2019
External database links:  
DIP:
DIP-48077N
ECOCYC:
EG11808-MONOMER
ECOLIWIKI:
b1848
INTERPRO:
IPR009813
INTERPRO:
IPR038627
PFAM:
PF07130
PRIDE:
P0ACY9
REFSEQ:
NP_416362
SMR:
P0ACY9
UNIPROT:
P0ACY9


Operon      
Name: yebG         
Operon arrangement:
Transcription unit        Promoter
yebG


Transcriptional Regulation      
Display Regulation             
Repressed by: LexA


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2189 (cluster) 1930416 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [6]
  promoter purTp5 1930719 forward Similarity to the consensus
Read more >
[ICWHO] [7]
  promoter purTp3 1930855 forward Similarity to the consensus
Read more >
[ICWHO] [7]
  promoter TSS_2190 1931849 reverse nd [RS-EPT-CBR] [6]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Benitez-Bellon E., Moreno-Hagelsieb G., Collado-Vides J., 2002, Evaluation of thresholds for the detection of binding sites for regulatory proteins in Escherichia coli K12 DNA., Genome Biol 3(3):RESEARCH0013

 [2] Faith JJ., Hayete B., Thaden JT., Mogno I., Wierzbowski J., Cottarel G., Kasif S., Collins JJ., Gardner TS., 2007, Large-scale mapping and validation of Escherichia coli transcriptional regulation from a compendium of expression profiles., PLoS Biol 5(1):e8

 [3] Khanin R., Vinciotti V., Wit E., 2006, Reconstructing repressor protein levels from expression of gene targets in Escherichia coli., Proc Natl Acad Sci U S A 103(49):18592-6

 [4] Lomba MR., Vasconcelos AT., Pacheco AB., de Almeida DF., 1997, Identification of yebG as a DNA damage-inducible Escherichia coli gene., FEMS Microbiol Lett 156(1):119-22

 [5] Muenter MM., Aiken A., Akanji JO., Baig S., Bellou S., Carlson A., Conway C., Cowell CM., DeLateur NA., Hester A., Joshi C., Kramer C., Leifer BS., Nash E., Qi MH., Travers M., Wong KC., Hu M., Gou N., Giese RW., Gu AZ., Beuning PJ., 2019, The response of Escherichia coli to the alkylating agents chloroacetaldehyde and styrene oxide., Mutat Res Genet Toxicol Environ Mutagen 840:1-10

 [6] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [7] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB