RegulonDB RegulonDB 10.9: Gene Form
   

torC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

torA torC torR torD torT TorR TorR TorR TorR torCp torCp torRp torRp

Gene      
Name: torC    Texpresso search in the literature
Synonym(s): ECK0987, EG11815, b0996
Genome position(nucleotides): 1058084 --> 1059256 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.24
External database links:  
ASAP:
ABE-0003370
CGSC:
29977
ECHOBASE:
EB1762
ECOLIHUB:
torC
OU-MICROARRAY:
b0996
STRING:
511145.b0996
COLOMBOS: torC


Product      
Name: cytochrome c menaquinol dehydrogenase TorC
Synonym(s): TorC
Sequence: Get amino acid sequence Fasta Format
Cellular location: cell wall,periplasmic space,inner membrane
Molecular weight: 43.607
Isoelectric point: 7.951
Motif(s):
 
Type Positions Sequence
17 -> 37 VLALVAIGIVIGIALIVLPHV
329 -> 329 C
11 -> 184 PSARWSVLALVAIGIVIGIALIVLPHVGIKVTSTTEFCVSCHSMQPVYEEYKQSVHFQNASGVRAECHDCHIPPDIPGMVKRKLEASNDIYQTFIAHSIDTPEKFEAKRAELAEREWARMKENNSATCRSCHNYDAMDHAKQHPEAARQMKVAAKDNQSCIDCHKGIAHQLPDM
194 -> 195 EL

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.7 - anaerobic respiration
  1 - metabolism --> 1.4 - energy production/transport --> 1.4.2 - electron acceptors
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.15 - large molecule carriers --> 1.6.15.1 - cytochromes
  3 - regulation --> 3.3 - genetic unit regulated --> 3.3.1 - operon
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0030288 - outer membrane-bounded periplasmic space
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
GO:0009276 - Gram-negative-bacterium-type cell wall
molecular_function GO:0005515 - protein binding
GO:0009055 - electron transfer activity
GO:0046872 - metal ion binding
GO:0005506 - iron ion binding
GO:0020037 - heme binding
biological_process GO:0009060 - aerobic respiration
GO:0009061 - anaerobic respiration
GO:0019645 - anaerobic electron transport chain
GO:0055114 - oxidation-reduction process
GO:0009968 - negative regulation of signal transduction
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-11014N
ECOCYC:
EG11815-MONOMER
ECOLIWIKI:
b0996
INTERPRO:
IPR009154
INTERPRO:
IPR038266
INTERPRO:
IPR036280
INTERPRO:
IPR011031
INTERPRO:
IPR005126
MODBASE:
P33226
PFAM:
PF03264
PRIDE:
P33226
PRODB:
PRO_000024086
PROSITE:
PS51008
REFSEQ:
NP_415516
UNIPROT:
P33226


Operon      
Name: torCAD         
Operon arrangement:
Transcription unit        Promoter
torCAD


Transcriptional Regulation      
Display Regulation             
Activated by: TorR
Repressed by: NarL


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB