RegulonDB RegulonDB 11.0: Gene Form

amiA gene in Escherichia coli K-12 genome

Gene local context to scale (view description)

hemF amiA ypeA yfeZ IHF IHF hemFp1 hemFp1 hemFp2 hemFp2 hemFp3 hemFp3 TSS_2747 (cluster) TSS_2747 (cluster) amiAp amiAp yfeZp3 yfeZp3

Name: amiA    Texpresso search in the literature
Synonym(s): ECK2430, EG11823, b2435, yfeE
Genome position(nucleotides): 2552352 --> 2553221
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
External database links:  

Name: N-acetylmuramoyl-L-alanine amidase A
Synonym(s): AmiA, YfeE
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space
Molecular weight: 31.412
Isoelectric point: 10.833
Type Positions Sequence Comment
1 -> 34 MSTFKPLKTLTSRRQVLKAGLAALTLSGMSQAIA UniProt: Tat-type signal; Non-Experimental Qualifier: potential;
39 -> 63 LKTSNGHSKPKAKKSGGKRVVVLDP UniProt: Disordered; Sequence Annotation Type: region of interest.


Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.7 - murein (peptidoglycan)
  6 - cell structure --> 6.2 - murein
Gene Ontology Terms (GO)  
cellular_component GO:0030288 - outer membrane-bounded periplasmic space
GO:0042597 - periplasmic space
molecular_function GO:0016787 - hydrolase activity
GO:0008270 - zinc ion binding
GO:0008745 - N-acetylmuramoyl-L-alanine amidase activity
biological_process GO:0051301 - cell division
GO:0009253 - peptidoglycan catabolic process
GO:0071555 - cell wall organization
GO:0071236 - cellular response to antibiotic
Note(s): Note(s): ...[more].
Reference(s): [1] Heidrich C., et al., 2002
[2] Parquet C., et al., 1983
[3] Peters NT., et al., 2011
[4] Uehara T., et al., 2008
[5] van Heijenoort J., et al., 1975
External database links:  

Name: amiA-hemF         
Operon arrangement:
Transcription unit        Promoter

Transcriptional Regulation      
Display Regulation             
Repressed by: IHF

Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yfeZp3 2551921 reverse nd [ICWHO] [6]
  promoter TSS_2747 (cluster) 2552242 forward nd [RS-EPT-CBR] [7]


 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates


 [1] Heidrich C., Ursinus A., Berger J., Schwarz H., Holtje JV., 2002, Effects of multiple deletions of murein hydrolases on viability, septum cleavage, and sensitivity to large toxic molecules in Escherichia coli., J Bacteriol 184(22):6093-9

 [2] Parquet C., Flouret B., Leduc M., Hirota Y., van Heijenoort J., 1983, N-acetylmuramoyl-L-alanine amidase of Escherichia coli K12. Possible physiological functions., Eur J Biochem 133(2):371-7

 [3] Peters NT., Dinh T., Bernhardt TG., 2011, A fail-safe mechanism in the septal ring assembly pathway generated by the sequential recruitment of cell separation amidases and their activators., J Bacteriol 193(18):4973-83

 [4] Uehara T., Park JT., 2008, Growth of Escherichia coli: significance of peptidoglycan degradation during elongation and septation., J Bacteriol 190(11):3914-22

 [5] van Heijenoort J., Parquet C., Flouret B., van Heijenoort Y., 1975, Envelope-bound N-acetylmuramyl-L-alanine amidase of Escherichia coli K 12. Purification and properties of the enzyme., Eur J Biochem 58(2):611-9

 [6] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [7] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.
