RegulonDB RegulonDB 10.9: Gene Form
   

yihG gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

polA yihF yihG DnaA terminator TSS_4538 TSS_4538 TSS_4537 TSS_4537 TSS_4536 TSS_4536 TSS_4535 TSS_4535 TSS_4534 TSS_4534 polAp polAp TSS_4533 TSS_4533 yihGp yihGp

Gene      
Name: yihG    Texpresso search in the literature
Synonym(s): ECK3854, EG11833, b3862
Genome position(nucleotides): 4045670 <-- 4046602 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
45.12
External database links:  
ASAP:
ABE-0012611
ECHOBASE:
EB1780
ECOLIHUB:
yihG
OU-MICROARRAY:
b3862
STRING:
511145.b3862
COLOMBOS: yihG


Product      
Name: 1-acylglycerol-3-phosphate O-acyltransferase YihG
Synonym(s): YihG
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 36.289
Isoelectric point: 10.131
Motif(s):
 
Type Positions Sequence
84 -> 216 EVHGLEGLSKKNWYLLICNHRSWADIVVLCVLFRKHIPMNKYFLKQQLAWVPFLGLACWSLDMPFMKRYSRAYLLRHPERRGKDVETTRRSCEKFRLHPTTIVNFVEGSRFTQEKHQQTHSTFQNLLPPKAAG
36 -> 53 PIIIAGIVKLLLPVPVIW
13 -> 32 ILAAITLLLSIVLTILVTIF
103 -> 108 HRSWAD

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0016740 - transferase activity
GO:0016746 - transferase activity, transferring acyl groups
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG11833-MONOMER
ECOLIWIKI:
b3862
INTERPRO:
IPR002123
MODBASE:
P32129
PFAM:
PF01553
PRIDE:
P32129
REFSEQ:
NP_418299
SMART:
SM00563
UNIPROT:
P32129


Operon      
Name: yihG         
Operon arrangement:
Transcription unit        Promoter
yihG


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4533 4046939 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4534 4047199 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4535 4048629 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4536 4048749 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4537 4049298 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4538 4049325 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB