RegulonDB RegulonDB 10.9: Gene Form
   

yihO gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yihO yihP ompL yihOp3 yihOp3 ompLp1 ompLp1

Gene      
Name: yihO    Texpresso search in the literature
Synonym(s): ECK3869, EG11841, b3876, squO
Genome position(nucleotides): 4064363 <-- 4065766 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
45.01
External database links:  
ASAP:
ABE-0012661
ECHOBASE:
EB1787
ECOLIHUB:
yihO
OU-MICROARRAY:
b3876
STRING:
511145.b3876
COLOMBOS: yihO


Product      
Name: putative sulfoquinovose transporter
Synonym(s): SquO, YihO
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 51.574
Isoelectric point: 8.741
Motif(s):
 
Type Positions Sequence
325 -> 345 SFTFVMFSCVAFFGTAFVNSL
18 -> 438 AYGMGDVGSNLMLCIGTLYLLKFYTDELGMPAYYGGIIFLVAKFFTAFTDMLTGFLLDSRKNIGPKGKFRPFILYAAVPAALIATLQFIATTFCLPVKTTIATALFMMFGLSYSLMNCSYGAMIPAITKNPNERAQLAAYRQGGATIGLLICTVAFIPLQSLFSDSTVGYACAALMFSIGGFIFMMLCYRGVKEHYVDTTPTGHKASILKSFCAIFRNPPLLVLCIANLCTLAAFNIKLAIQVYYTQYVLNDINLLSWMGFFSMGCILIGVLLVPLTVKCFGKKQVYLAGMVLWAVGDILNYFWGSNSFTFVMFSCVAFFGTAFVNSLNWALVPDTVDYGEWKTGIRAEGSVYTGYTFFRKISAALAGFLPGIMLTQIGYVPNIAQSDATLQGLRQLIFIWPCALAIIAALTMGFFYTLNE
121 -> 141 ALFMMFGLSYSLMNCSYGAMI
275 -> 295 WMGFFSMGCILIGVLLVPLTV
17 -> 37 IAYGMGDVGSNLMLCIGTLYL

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.2 - Electrochemical potential driven transporters --> 4.2.A - Porters (Uni-, Sym- and Antiporters)
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0015293 - symporter activity
GO:0015294 - solute:cation symporter activity
GO:0022857 - transmembrane transporter activity
GO:1901682 - sulfur compound transmembrane transporter activity
biological_process GO:0008643 - carbohydrate transport
GO:0006814 - sodium ion transport
GO:0034220 - ion transmembrane transport
GO:0055085 - transmembrane transport
GO:0071702 - organic substance transport
GO:0072348 - sulfur compound transport
GO:0098655 - cation transmembrane transport
Note(s): Note(s): ...[more].
Reference(s): [1] Jindal S., et al., 2019
External database links:  
ECOCYC:
YIHO-MONOMER
ECOLIWIKI:
b3876
INTERPRO:
IPR018043
INTERPRO:
IPR039672
INTERPRO:
IPR036259
INTERPRO:
IPR001927
MODBASE:
P32136
PANTHER:
PTHR11328
PFAM:
PF13347
PRIDE:
P32136
PROSITE:
PS00872
REFSEQ:
YP_026275
UNIPROT:
P32136


Operon      
Name: yihPO         
Operon arrangement:
Transcription unit        Promoter
yihPO


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ompLp1 4064479 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yihOp3 4065971 reverse Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Jindal S., Yang L., Day PJ., Kell DB., 2019, Involvement of multiple influx and efflux transporters in the accumulation of cationic fluorescent dyes by Escherichia coli., BMC Microbiol 19(1):195

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB