RegulonDB RegulonDB 10.9: Gene Form
   

rhaA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

rhaB rhaA rhaS rhaD RhaS RhaR RhaS RhaR CRP CRP CRP CRP RhaS RhaS rhaSp rhaSp rhaBp rhaBp rhaDp rhaDp

Gene      
Name: rhaA    Texpresso search in the literature
Synonym(s): ECK3896, EG11867, b3903
Genome position(nucleotides): 4094723 <-- 4095982 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.11
External database links:  
ASAP:
ABE-0012736
CGSC:
292
ECHOBASE:
EB1813
ECOLIHUB:
rhaA
OU-MICROARRAY:
b3903
STRING:
511145.b3903
COLOMBOS: rhaA


Product      
Name: L-rhamnose isomerase
Synonym(s): RhaA
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 47.199
Isoelectric point: 5.575
Motif(s):
 
Type Positions Sequence
3 -> 418 TQLEQAWELAKQRFAAVGIDVEEALRQLDRLPVSMHCWQGDDVSGFENPEGSLTGGIQATGNYPGKARNASELRADLEQAMRLIPGPKRLNLHAIYLESDTPVSRDQIKPEHFKNWVEWAKANQLGLDFNPSCFSHPLSADGFTLSHADDSIRQFWIDHCKASRRVSAYFGEQLGTPSVMNIWIPDGMKDITVDRLAPRQRLLAALDEVISEKLNPAHHIDAVESKLFGIGAESYTVGSNEFYMGYATSRQTALCLDAGHFHPTEVISDKISAAMLYVPQLLLHVSRPVRWDSDHVVLLDDETQAIASEIVRHDLFDRVHIGLDFFDASINRIAAWVIGTRNMKKALLRALLEPTAELRKLEAAGDYTARLALLEEQKSLPWQAVWEMYCQRHDTPAGSEWLESVRAYEKEILSRR
359 -> 360 EL
366 -> 366 A

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
GO:0032991 - protein-containing complex
molecular_function GO:0033296 - rhamnose binding
GO:0016853 - isomerase activity
GO:0046872 - metal ion binding
GO:0008270 - zinc ion binding
GO:0008740 - L-rhamnose isomerase activity
GO:0030145 - manganese ion binding
GO:0042802 - identical protein binding
biological_process GO:0019299 - rhamnose metabolic process
GO:0019301 - rhamnose catabolic process
GO:0019324 - L-lyxose metabolic process
GO:0051289 - protein homotetramerization
Note(s): Note(s): ...[more].
Reference(s): [1] Chen YM., et al., 1987
[2] Jung SM., et al., 2019
[3] Leang K., et al., 2004
[4] Moralejo P., et al., 1993
[5] Plunkett G., et al., 1993
[6] Sanchez JC., et al., 1994
[7] Sugiyama M., et al., 2007
[8] TECCE G., et al., 1956
[9] WILSON DM., et al., 1957
[10] Xu W., et al., 2016
External database links:  
DIP:
DIP-10690N
DISPROT:
DP00429
ECOCYC:
RHAMNISOM-MONOMER
ECOLIWIKI:
b3903
INTERPRO:
IPR036237
INTERPRO:
IPR009308
MODBASE:
P32170
PDB:
1DE6
PDB:
1DE5
PDB:
1D8W
PFAM:
PF06134
PRIDE:
P32170
PRODB:
PRO_000023733
REFSEQ:
YP_026276
SMR:
P32170
UNIPROT:
P32170


Operon      
Name: rhaBAD         
Operon arrangement:
Transcription unit        Promoter
rhaD
rhaBAD


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, RhaS


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Chen YM., Tobin JF., Zhu Y., Schleif RF., Lin EC., 1987, Cross-induction of the L-fucose system by L-rhamnose in Escherichia coli., J Bacteriol 169(8):3712-9

 [2] Jung SM., Chin YW., Lee YG., Seo JH., 2019, Enhanced production of 2'-fucosyllactose from fucose by elimination of rhamnose isomerase and arabinose isomerase in engineered Escherichia coli., Biotechnol Bioeng 116(9):2412-2417

 [3] Leang K., Maekawa K., Menavuvu BT., Morimoto K., Granstrom TB., Takada G., Izumori K., 2004, A novel enzymatic approach to the massproduction of L-galactose from L-sorbose., J Biosci Bioeng 97(6):383-8

 [4] Moralejo P., Egan SM., Hidalgo E., Aguilar J., 1993, Sequencing and characterization of a gene cluster encoding the enzymes for L-rhamnose metabolism in Escherichia coli., J Bacteriol 175(17):5585-94

 [5] Plunkett G., Burland V., Daniels DL., Blattner FR., 1993, Analysis of the Escherichia coli genome. III. DNA sequence of the region from 87.2 to 89.2 minutes., Nucleic Acids Res 21(15):3391-8

 [6] Sanchez JC., Gimenez R., Schneider A., Fessner WD., Baldoma L., Aguilar J., Badia J., 1994, Activation of a cryptic gene encoding a kinase for L-xylulose opens a new pathway for the utilization of L-lyxose by Escherichia coli., J Biol Chem 269(47):29665-9

 [7] Sugiyama M., Hong Z., Greenberg WA., Wong CH., 2007, In vivo selection for the directed evolution of L-rhamnulose aldolase from L-rhamnulose-1-phosphate aldolase (RhaD)., Bioorg Med Chem 15(17):5905-11

 [8] TECCE G., DI GIROLAMO M., 1956, [Various properties of L-rhamnose isomerase of E. coli]., Boll Soc Ital Biol Sper 32(9):1195-8

 [9] WILSON DM., AJL S., 1957, Metabolism of L-rhamnose by Escherichia coli. I. L-rhamnose isomerase., J Bacteriol 73(3):410-4

 [10] Xu W., Zhang W., Zhang T., Jiang B., Mu W., 2016, L-Rhamnose isomerase and its use for biotechnological production of rare sugars., Appl Microbiol Biotechnol 100(7):2985-92


RegulonDB