RegulonDB RegulonDB 10.9: Gene Form
   

yiiQ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

tpiA yiiQ yiiR Cra yiiQp4 yiiQp4 TSS_4620 TSS_4620 TSS_4619 (cluster) TSS_4619 (cluster) tpiAp2 tpiAp2 TSS_4617 TSS_4617 tpiAp1 tpiAp1 TSS_4616 TSS_4616 TSS_4615 TSS_4615 TSS_4614 TSS_4614 TSS_4613 TSS_4613 TSS_4612 TSS_4612

Gene      
Name: yiiQ    Texpresso search in the literature
Synonym(s): ECK3912, EG11874, b3920
Genome position(nucleotides): 4111615 <-- 4112214 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.17
External database links:  
ASAP:
ABE-0012802
ECHOBASE:
EB1820
ECOLIHUB:
yiiQ
OU-MICROARRAY:
b3920
STRING:
511145.b3920
COLOMBOS: yiiQ


Product      
Name: DUF1454 domain-containing protein YiiQ
Synonym(s): YiiQ
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 21.763
Isoelectric point: 9.341
Motif(s):
 
Type Positions Sequence
24 -> 199 QTPDTATTAPYLLAGAPTFDLSISQFREDFNSQNPSLPLNEFRAIDSSPDKANLTRAASKINENLYASTALERGTLKIKSIQMTWLPIQGPEQKAAKAKAQEYMAAVIRTLTPLMTKTQSQKKLQSLLTAGKNKRYYTETEGALRYVVADNGEKGLTFAVEPIKLALSESLEGLNK
9 -> 192 FLLCSALTVTTEAHAQTPDTATTAPYLLAGAPTFDLSISQFREDFNSQNPSLPLNEFRAIDSSPDKANLTRAASKINENLYASTALERGTLKIKSIQMTWLPIQGPEQKAAKAKAQEYMAAVIRTLTPLMTKTQSQKKLQSLLTAGKNKRYYTETEGALRYVVADNGEKGLTFAVEPIKLALSE
1 -> 23 MKPGCTLFFLLCSALTVTTEAHA

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG11874-MONOMER
ECOLIWIKI:
b3920
INTERPRO:
IPR009918
PFAM:
PF07305
PRIDE:
P32160
REFSEQ:
NP_418355
UNIPROT:
P32160


Operon      
Name: yiiQ         
Operon arrangement:
Transcription unit        Promoter
yiiQ


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4612 4111330 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_4613 4111496 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_4614 4111500 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_4615 4111507 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_4616 4111513 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_4617 4111541 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_4619 (cluster) 4111575 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_4620 4112237 reverse nd [RS-EPT-CBR] [1]
  promoter yiiQp4 4112312 reverse Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB