RegulonDB RegulonDB 10.9: Gene Form
   

yiiR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yiiQ yiiR yiiS YdeO Cra ppGpp yiiSp yiiSp yiiQp4 yiiQp4 TSS_4620 TSS_4620

Gene      
Name: yiiR    Texpresso search in the literature
Synonym(s): ECK3913, EG11875, b3921
Genome position(nucleotides): 4112315 --> 4112755 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.43
External database links:  
ASAP:
ABE-0012809
ECHOBASE:
EB1821
ECOLIHUB:
yiiR
OU-MICROARRAY:
b3921
STRING:
511145.b3921
COLOMBOS: yiiR


Product      
Name: DUF805 domain-containing protein YiiR
Synonym(s): YiiR
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 16.542
Isoelectric point: 10.467
Motif(s):
 
Type Positions Sequence
8 -> 132 FSFKGRIGRRDFWIWIGLWFAGMLVLFSLAGKNLLDIQTAAFCLVCLLWPTAAVTVKRLHDRGRSGAWAFLMIVAWMLLAGNWAILPGVWQWAVGRFVPTLILVMMLIDLGAFVGTQGENKYGKD

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG11875-MONOMER
ECOLIWIKI:
b3921
INTERPRO:
IPR008523
PANTHER:
PTHR34980
PFAM:
PF05656
PRIDE:
P0AF34
REFSEQ:
NP_418356
UNIPROT:
P0AF34


Operon      
Name: yiiR         
Operon arrangement:
Transcription unit        Promoter
yiiR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4620 4112237 reverse nd [RS-EPT-CBR] [1]
  promoter yiiQp4 4112312 reverse Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB