RegulonDB RegulonDB 10.10: Gene Form
   

yiiX gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yiiX metJ rpmE

Gene      
Name: yiiX    Texpresso search in the literature
Synonym(s): ECK3929, EG11882, b3937
Genome position(nucleotides): 4127286 <-- 4127894 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.38
External database links:  
ASAP:
ABE-0012869
ECHOBASE:
EB1828
ECOLIHUB:
yiiX
OU-MICROARRAY:
b3937
STRING:
511145.b3937
COLOMBOS: yiiX


Product      
Name: putative lipid-binding hydrolase YiiX
Synonym(s): YiiX
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 23.14
Isoelectric point: 10.058
Motif(s):
 
Type Positions Sequence
21 -> 193 PQTGDIIFQISRSSQSKAIQLATHTDYSHTGMLVIRNKKPYVFEAVGPVKYTPLKQWIAHGEKGKYVVRRVEGGLSVEQQQKLAQTAKRYLGKPYDFSFSWSDDRQYCSEVVWKVYQNALGMRVGEQQKLKEFDLSSPQVQAKLKERYGKNIPLEETVVSPQAVFDAPQLTTV
45 -> 45 T
1 -> 18 MKNRLLILSLLVSVPAFA
19 -> 202 WQPQTGDIIFQISRSSQSKAIQLATHTDYSHTGMLVIRNKKPYVFEAVGPVKYTPLKQWIAHGEKGKYVVRRVEGGLSVEQQQKLAQTAKRYLGKPYDFSFSWSDDRQYCSEVVWKVYQNALGMRVGEQQKLKEFDLSSPQVQAKLKERYGKNIPLEETVVSPQAVFDAPQLTTVAKEWPLFSW
98 -> 98 E

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
Note(s): Note(s): ...[more].
Reference(s): [1] Xu Q., et al., 2011
External database links:  
ECOCYC:
EG11882-MONOMER
ECOLIWIKI:
b3937
INTERPRO:
IPR038765
INTERPRO:
IPR024453
PFAM:
PF05708
PRIDE:
P32167
REFSEQ:
NP_418372
SMR:
P32167
UNIPROT:
P32167


Operon      
Name: yiiX         
Operon arrangement:
Transcription unit        Promoter
yiiX


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Xu Q., Rawlings ND., Chiu HJ., Jaroszewski L., Klock HE., Knuth MW., Miller MD., Elsliger MA., Deacon AM., Godzik A., Lesley SA., Wilson IA., 2011, Structural analysis of papain-like NlpC/P60 superfamily enzymes with a circularly permuted topology reveals potential lipid binding sites., PLoS One 6(7):e22013


RegulonDB